BLASTX nr result
ID: Cephaelis21_contig00054321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00054321 (270 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD45561.1| reverse transcriptase [Elaeis guineensis] 59 3e-07 emb|CAA11922.1| Reverse Transcriptase [Picea abies] 57 1e-06 emb|CAD45562.1| reverse transcriptase [Elaeis guineensis] 56 3e-06 emb|CAD45564.1| reverse transcriptase [Elaeis guineensis] 56 3e-06 >emb|CAD45561.1| reverse transcriptase [Elaeis guineensis] Length = 137 Score = 59.3 bits (142), Expect = 3e-07 Identities = 30/68 (44%), Positives = 41/68 (60%) Frame = -2 Query: 269 HNMIIKMDMLKAFDRVSW*SLKLFLAKFGFH*RSIEFLLNNFHGGWFLVLVNEAPTCFFK 90 HN+IIK+DM KA+DR+ W L L +FGFH + ++ F WF VL N FFK Sbjct: 66 HNVIIKLDMGKAYDRLEWDFLFQVLLRFGFHPGWVNYIRAMFTNCWFSVLYNGGVHGFFK 125 Query: 89 FSWGIKQG 66 + G++QG Sbjct: 126 STRGLRQG 133 >emb|CAA11922.1| Reverse Transcriptase [Picea abies] Length = 194 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/69 (43%), Positives = 41/69 (59%) Frame = -2 Query: 263 MIIKMDMLKAFDRVSW*SLKLFLAKFGFH*RSIEFLLNNFHGGWFLVLVNEAPTCFFKFS 84 M+IK+D+ KAFD+ W LK L FGF + ++LN +F +LVNE P+ F S Sbjct: 124 MLIKLDLSKAFDKAKWFYLKATLPAFGFDHTWVNWILNLTSSAFFSILVNEVPSQPFSAS 183 Query: 83 WGIKQGGSF 57 GI+QG F Sbjct: 184 RGIRQGYPF 192 >emb|CAD45562.1| reverse transcriptase [Elaeis guineensis] Length = 137 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/68 (42%), Positives = 40/68 (58%) Frame = -2 Query: 269 HNMIIKMDMLKAFDRVSW*SLKLFLAKFGFH*RSIEFLLNNFHGGWFLVLVNEAPTCFFK 90 HN+IIK+DM KA+D + W L L +FGFH + ++ F WF VL N FFK Sbjct: 66 HNVIIKLDMGKAYDWLEWDFLFQVLLRFGFHPGWVNYIRAMFTNCWFSVLYNGGVHGFFK 125 Query: 89 FSWGIKQG 66 + G++QG Sbjct: 126 STRGLRQG 133 >emb|CAD45564.1| reverse transcriptase [Elaeis guineensis] Length = 137 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/68 (42%), Positives = 40/68 (58%) Frame = -2 Query: 269 HNMIIKMDMLKAFDRVSW*SLKLFLAKFGFH*RSIEFLLNNFHGGWFLVLVNEAPTCFFK 90 HN+IIK DM +A+DR+ W L L +FGFH + ++ F WF VL N FFK Sbjct: 66 HNVIIKPDMGEAYDRLEWDFLFQVLLRFGFHPGWVNYIRAMFTNCWFSVLYNGGVHGFFK 125 Query: 89 FSWGIKQG 66 + G++QG Sbjct: 126 STRGLRQG 133