BLASTX nr result
ID: Cephaelis21_contig00053693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00053693 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526377.1| NAC domain-containing protein, putative [Ric... 97 2e-18 ref|XP_002282243.2| PREDICTED: uncharacterized protein LOC100253... 96 3e-18 emb|CBI16292.3| unnamed protein product [Vitis vinifera] 96 3e-18 ref|XP_003597198.1| NAC domain-containing protein [Medicago trun... 96 4e-18 ref|XP_002519550.1| transcription factor, putative [Ricinus comm... 94 1e-17 >ref|XP_002526377.1| NAC domain-containing protein, putative [Ricinus communis] gi|223534336|gb|EEF36048.1| NAC domain-containing protein, putative [Ricinus communis] Length = 336 Score = 96.7 bits (239), Expect = 2e-18 Identities = 40/53 (75%), Positives = 47/53 (88%) Frame = -1 Query: 161 SSFQFPPGVRFHPSDEELIVYYLHNKVKSRPLPAAVVGEIELYSYNPWDLPKK 3 S FQFPPG RFHPSDEELI++YL N+V SRPLPA+++ EI+LY YNPWDLPKK Sbjct: 5 SDFQFPPGFRFHPSDEELIIHYLRNRVASRPLPASIIAEIDLYKYNPWDLPKK 57 >ref|XP_002282243.2| PREDICTED: uncharacterized protein LOC100253566 [Vitis vinifera] Length = 390 Score = 95.9 bits (237), Expect = 3e-18 Identities = 43/59 (72%), Positives = 49/59 (83%) Frame = -1 Query: 179 METQFISSFQFPPGVRFHPSDEELIVYYLHNKVKSRPLPAAVVGEIELYSYNPWDLPKK 3 ME + SSFQFPPG RFHPSDEELIV+YL KV S PLPA+V+ EI+LY YNPW+LPKK Sbjct: 1 MEREPNSSFQFPPGFRFHPSDEELIVHYLQKKVTSHPLPASVIAEIDLYKYNPWELPKK 59 >emb|CBI16292.3| unnamed protein product [Vitis vinifera] Length = 376 Score = 95.9 bits (237), Expect = 3e-18 Identities = 43/59 (72%), Positives = 49/59 (83%) Frame = -1 Query: 179 METQFISSFQFPPGVRFHPSDEELIVYYLHNKVKSRPLPAAVVGEIELYSYNPWDLPKK 3 ME + SSFQFPPG RFHPSDEELIV+YL KV S PLPA+V+ EI+LY YNPW+LPKK Sbjct: 1 MEREPNSSFQFPPGFRFHPSDEELIVHYLQKKVTSHPLPASVIAEIDLYKYNPWELPKK 59 >ref|XP_003597198.1| NAC domain-containing protein [Medicago truncatula] gi|87241197|gb|ABD33055.1| No apical meristem (NAM) protein [Medicago truncatula] gi|355486246|gb|AES67449.1| NAC domain-containing protein [Medicago truncatula] Length = 323 Score = 95.5 bits (236), Expect = 4e-18 Identities = 39/53 (73%), Positives = 48/53 (90%) Frame = -1 Query: 161 SSFQFPPGVRFHPSDEELIVYYLHNKVKSRPLPAAVVGEIELYSYNPWDLPKK 3 S++ FPPG RFHPSDEELIV+YL NK+KSRPLPA+++ EI+LY YNPW+LPKK Sbjct: 10 SNYTFPPGFRFHPSDEELIVHYLQNKIKSRPLPASIIAEIDLYKYNPWELPKK 62 >ref|XP_002519550.1| transcription factor, putative [Ricinus communis] gi|223541413|gb|EEF42964.1| transcription factor, putative [Ricinus communis] Length = 308 Score = 93.6 bits (231), Expect = 1e-17 Identities = 41/59 (69%), Positives = 47/59 (79%) Frame = -1 Query: 179 METQFISSFQFPPGVRFHPSDEELIVYYLHNKVKSRPLPAAVVGEIELYSYNPWDLPKK 3 MET+ S PPG RFHPSDEELIVYYL NKV S PLPA+VV +++LY YNPW+LPKK Sbjct: 1 METKTTSDIHLPPGFRFHPSDEELIVYYLKNKVTSNPLPASVVADLDLYKYNPWELPKK 59