BLASTX nr result
ID: Cephaelis21_contig00053599
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00053599 (337 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG51420.1|AC009465_20 unknown protein; 78996-83414 [Arabidop... 58 7e-07 >gb|AAG51420.1|AC009465_20 unknown protein; 78996-83414 [Arabidopsis thaliana] Length = 699 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 92 KLLFREFSITSMTGGYRRVFQKPNDYEWEL 3 K FREFSITSMTGGYRRVFQKP D+EWEL Sbjct: 544 KYCFREFSITSMTGGYRRVFQKPIDFEWEL 573