BLASTX nr result
ID: Cephaelis21_contig00053581
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00053581 (232 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524786.1| conserved hypothetical protein [Ricinus comm... 74 1e-11 emb|CAB78008.1| putative protein [Arabidopsis thaliana] gi|73210... 72 6e-11 gb|ABW81175.1| non-LTR retrotransposon transposase [Arabidopsis ... 69 3e-10 emb|CAB10337.1| reverse transcriptase like protein [Arabidopsis ... 69 5e-10 gb|AAD37021.1| putative non-LTR retrolelement reverse transcript... 69 5e-10 >ref|XP_002524786.1| conserved hypothetical protein [Ricinus communis] gi|223535970|gb|EEF37629.1| conserved hypothetical protein [Ricinus communis] Length = 105 Score = 74.3 bits (181), Expect = 1e-11 Identities = 36/62 (58%), Positives = 44/62 (70%) Frame = -3 Query: 215 RKAISEALGFQQVEDLGIYLGVPLLHKRITKNTYKFIVDKICHKLEGWPAKQLSFAGRIT 36 R+ ++ LG++ DLG YLG+P+LH RI KNTY+ IVDKI KL GW LS AGRIT Sbjct: 44 RRILASKLGYEMTSDLGKYLGMPILHGRINKNTYQGIVDKIGSKLAGWSNSCLSLAGRIT 103 Query: 35 LA 30 LA Sbjct: 104 LA 105 >emb|CAB78008.1| putative protein [Arabidopsis thaliana] gi|7321072|emb|CAB82119.1| putative protein [Arabidopsis thaliana] Length = 947 Score = 71.6 bits (174), Expect = 6e-11 Identities = 32/69 (46%), Positives = 48/69 (69%) Frame = -3 Query: 212 KAISEALGFQQVEDLGIYLGVPLLHKRITKNTYKFIVDKICHKLEGWPAKQLSFAGRITL 33 K IS+ G + +LG YLG+P+L +RI K+T+ +++++ +L GW + LSFAGR+TL Sbjct: 410 KLISKESGIKSTRELGKYLGMPILQRRINKDTFGEVLERVSSRLAGWKGRSLSFAGRLTL 469 Query: 32 AKSVLLAIP 6 KSVL IP Sbjct: 470 TKSVLSLIP 478 >gb|ABW81175.1| non-LTR retrotransposon transposase [Arabidopsis cebennensis] Length = 799 Score = 69.3 bits (168), Expect = 3e-10 Identities = 33/69 (47%), Positives = 48/69 (69%) Frame = -3 Query: 212 KAISEALGFQQVEDLGIYLGVPLLHKRITKNTYKFIVDKICHKLEGWPAKQLSFAGRITL 33 K IS+ G + ++LG YLG+P+L KRI K+T+ I+ ++ +L GW + LS AGR+TL Sbjct: 188 KFISDESGIKSTKELGKYLGMPVLQKRINKDTFGEILLRVSSRLAGWKGRMLSLAGRLTL 247 Query: 32 AKSVLLAIP 6 KSVL +IP Sbjct: 248 TKSVLSSIP 256 >emb|CAB10337.1| reverse transcriptase like protein [Arabidopsis thaliana] gi|7268307|emb|CAB78601.1| reverse transcriptase like protein [Arabidopsis thaliana] Length = 929 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/67 (44%), Positives = 47/67 (70%) Frame = -3 Query: 206 ISEALGFQQVEDLGIYLGVPLLHKRITKNTYKFIVDKICHKLEGWPAKQLSFAGRITLAK 27 I+ G +LG YLG+P+L KRI K+T+ +++++ +L GW ++ LS AGRITL K Sbjct: 533 ITAETGIGSTRELGKYLGMPVLQKRINKDTFGEVLERVSSRLSGWKSRSLSLAGRITLTK 592 Query: 26 SVLLAIP 6 +VL++IP Sbjct: 593 AVLMSIP 599 >gb|AAD37021.1| putative non-LTR retrolelement reverse transcriptase [Arabidopsis thaliana] Length = 732 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/69 (46%), Positives = 47/69 (68%) Frame = -3 Query: 212 KAISEALGFQQVEDLGIYLGVPLLHKRITKNTYKFIVDKICHKLEGWPAKQLSFAGRITL 33 K IS+ G +LG YLG+P+L +RI K+T+ I++K+ +L GW + LS AGR+TL Sbjct: 258 KLISDESGISSTRELGKYLGMPVLQRRINKDTFGDILEKLTTRLAGWKGRFLSLAGRVTL 317 Query: 32 AKSVLLAIP 6 K+VL +IP Sbjct: 318 TKAVLSSIP 326