BLASTX nr result
ID: Cephaelis21_contig00053310
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00053310 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN64135.1| hypothetical protein VITISV_033516 [Vitis vinifera] 55 6e-06 >emb|CAN64135.1| hypothetical protein VITISV_033516 [Vitis vinifera] Length = 177 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/94 (31%), Positives = 49/94 (52%), Gaps = 1/94 (1%) Frame = +3 Query: 6 LDDENIIV*EPTSAGNFVLSSVYNALCVPSQEYPQLKIIWGSAIPLRVSFFLWRLMNFFL 185 +D+E+ ++ P G + S+Y A+ + S Y +KIIW S + +V FF W Sbjct: 1 MDEEDRVLWTPMKIGKXSVKSLYKAVELESSVYFPMKIIWNSWVQPKVCFFAWEASWGKA 60 Query: 186 PFPEVLNGLGFCLPSKCYICCS-MNSIEHCFLGC 284 + + G+ LP++CY+C S SI+H L C Sbjct: 61 LTLDQIQKRGWALPNRCYLCHSNEESIDHLLLHC 94