BLASTX nr result
ID: Cephaelis21_contig00053244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00053244 (286 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002440870.1| hypothetical protein SORBIDRAFT_09g010571 [S... 111 7e-23 ref|XP_002445353.1| hypothetical protein SORBIDRAFT_07g011900 [S... 110 9e-23 ref|XP_002440855.1| hypothetical protein SORBIDRAFT_09g008991 [S... 107 1e-21 dbj|BAL46523.1| hypothetical protein [Gentiana scabra x Gentiana... 102 2e-21 emb|CAJ65807.1| polyprotein [Citrus sinensis] 106 2e-21 >ref|XP_002440870.1| hypothetical protein SORBIDRAFT_09g010571 [Sorghum bicolor] gi|241946155|gb|EES19300.1| hypothetical protein SORBIDRAFT_09g010571 [Sorghum bicolor] Length = 386 Score = 111 bits (277), Expect = 7e-23 Identities = 51/72 (70%), Positives = 60/72 (83%) Frame = -1 Query: 217 YKLYAKFSKCEFWLDLIPFLGHIISEEGVIVDPTKVEDILNWKWLTMVTEVRSFLGLARY 38 ++LYAKFSKCEFWLD + FLGH++S EGV VDP KVED+LNWK T V EVRSFLG+A Y Sbjct: 193 HELYAKFSKCEFWLDKVHFLGHVLSAEGVAVDPGKVEDVLNWKPPTTVHEVRSFLGMAGY 252 Query: 37 YWRFVQDFSRIA 2 Y RF+ DFSR+A Sbjct: 253 YRRFIPDFSRVA 264 >ref|XP_002445353.1| hypothetical protein SORBIDRAFT_07g011900 [Sorghum bicolor] gi|241941703|gb|EES14848.1| hypothetical protein SORBIDRAFT_07g011900 [Sorghum bicolor] Length = 1488 Score = 110 bits (276), Expect = 9e-23 Identities = 50/72 (69%), Positives = 62/72 (86%) Frame = -1 Query: 217 YKLYAKFSKCEFWLDLIPFLGHIISEEGVIVDPTKVEDILNWKWLTMVTEVRSFLGLARY 38 ++LYAKFSKCEFWL +PFLGHI+SEEG+ VDP+KV+++L+WK T V EVRSFLGLA Y Sbjct: 671 HQLYAKFSKCEFWLKKVPFLGHILSEEGISVDPSKVQEVLDWKAPTSVHEVRSFLGLAGY 730 Query: 37 YWRFVQDFSRIA 2 Y RF+ DFS+IA Sbjct: 731 YRRFIPDFSKIA 742 >ref|XP_002440855.1| hypothetical protein SORBIDRAFT_09g008991 [Sorghum bicolor] gi|241946140|gb|EES19285.1| hypothetical protein SORBIDRAFT_09g008991 [Sorghum bicolor] Length = 329 Score = 107 bits (267), Expect = 1e-21 Identities = 50/72 (69%), Positives = 59/72 (81%) Frame = -1 Query: 217 YKLYAKFSKCEFWLDLIPFLGHIISEEGVIVDPTKVEDILNWKWLTMVTEVRSFLGLARY 38 ++LYAKFSKCEFWLD + FLGH++S EGV VD KVED+LNWK T V EVRSFLG+A Y Sbjct: 182 HQLYAKFSKCEFWLDKVHFLGHVLSAEGVAVDLGKVEDVLNWKPPTTVHEVRSFLGMAGY 241 Query: 37 YWRFVQDFSRIA 2 Y RF+ DFSR+A Sbjct: 242 YRRFIPDFSRVA 253 >dbj|BAL46523.1| hypothetical protein [Gentiana scabra x Gentiana triflora] Length = 1152 Score = 102 bits (254), Expect(2) = 2e-21 Identities = 47/71 (66%), Positives = 56/71 (78%) Frame = -1 Query: 214 KLYAKFSKCEFWLDLIPFLGHIISEEGVIVDPTKVEDILNWKWLTMVTEVRSFLGLARYY 35 KLYAKFSKCEFWL + FLGH+IS +G+ VDP K+E + W T VTE+RSFLGLA YY Sbjct: 394 KLYAKFSKCEFWLKQVSFLGHVISGDGIQVDPAKIEAVSKWPRPTTVTEIRSFLGLAGYY 453 Query: 34 WRFVQDFSRIA 2 +FVQDFS+IA Sbjct: 454 RKFVQDFSKIA 464 Score = 25.0 bits (53), Expect(2) = 2e-21 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -2 Query: 285 MDLMQRVF*TYLDQ 244 MDLMQRVF YLD+ Sbjct: 347 MDLMQRVFMPYLDK 360 >emb|CAJ65807.1| polyprotein [Citrus sinensis] Length = 533 Score = 106 bits (265), Expect = 2e-21 Identities = 49/71 (69%), Positives = 59/71 (83%) Frame = -1 Query: 214 KLYAKFSKCEFWLDLIPFLGHIISEEGVIVDPTKVEDILNWKWLTMVTEVRSFLGLARYY 35 +LYAKFSKCEFWLD + FLGH+IS EG+ VDP K+E ++NW+ T VTEVRSFLGLA YY Sbjct: 31 QLYAKFSKCEFWLDKVVFLGHVISAEGIYVDPQKIEAVVNWERPTNVTEVRSFLGLAGYY 90 Query: 34 WRFVQDFSRIA 2 RFV+ FS+IA Sbjct: 91 RRFVEGFSKIA 101