BLASTX nr result
ID: Cephaelis21_contig00052438
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00052438 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC33015.1| hypothetical protein [Antirrhinum hispanicum] 68 9e-10 >emb|CAC33015.1| hypothetical protein [Antirrhinum hispanicum] Length = 1299 Score = 67.8 bits (164), Expect = 9e-10 Identities = 28/71 (39%), Positives = 42/71 (59%) Frame = +2 Query: 95 DLALERFHKFHPPKFNGIGGEEAAEKWMETMTDIFEAMQYTEARKVGFGKFQLEGSAKAW 274 D ERF + PP+F G + E W+E M IF Y E +KV F F+LE +A+ W Sbjct: 249 DQLFERFLRLQPPRFLGEPDDRKPESWVEEMEKIFSVTNYKEEKKVNFAAFRLEDAARHW 308 Query: 275 YRIIEEKWKQE 307 +RI++++WK + Sbjct: 309 WRILDQRWKND 319