BLASTX nr result
ID: Cephaelis21_contig00052357
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00052357 (331 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529542.1| heat shock protein binding protein, putative... 66 3e-09 ref|XP_002269109.2| PREDICTED: dnaJ homolog subfamily B member 1... 61 8e-08 emb|CBI23775.3| unnamed protein product [Vitis vinifera] 61 8e-08 >ref|XP_002529542.1| heat shock protein binding protein, putative [Ricinus communis] gi|223530990|gb|EEF32845.1| heat shock protein binding protein, putative [Ricinus communis] Length = 257 Score = 66.2 bits (160), Expect = 3e-09 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = -1 Query: 226 MADPTSRSPPTNFYGILGISKTASLADIAKAYKSLVTRWQPDKNTSN 86 M DP RS +FYGILGI K+ASL D++KAYKSLVT+W PDKN SN Sbjct: 1 MGDPP-RSQTVDFYGILGIPKSASLKDVSKAYKSLVTKWHPDKNPSN 46 >ref|XP_002269109.2| PREDICTED: dnaJ homolog subfamily B member 13-like [Vitis vinifera] Length = 259 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/47 (61%), Positives = 34/47 (72%) Frame = -1 Query: 226 MADPTSRSPPTNFYGILGISKTASLADIAKAYKSLVTRWQPDKNTSN 86 M DP RSP +FY ILGIS+ AS+ D+ KAYKSL +W PDKN SN Sbjct: 1 MGDPP-RSPTPDFYSILGISRGASILDVCKAYKSLAKKWHPDKNPSN 46 >emb|CBI23775.3| unnamed protein product [Vitis vinifera] Length = 316 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/47 (61%), Positives = 34/47 (72%) Frame = -1 Query: 226 MADPTSRSPPTNFYGILGISKTASLADIAKAYKSLVTRWQPDKNTSN 86 M DP RSP +FY ILGIS+ AS+ D+ KAYKSL +W PDKN SN Sbjct: 1 MGDPP-RSPTPDFYSILGISRGASILDVCKAYKSLAKKWHPDKNPSN 46