BLASTX nr result
ID: Cephaelis21_contig00052243
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00052243 (344 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275344.2| PREDICTED: pentatricopeptide repeat-containi... 166 2e-39 emb|CBI25349.3| unnamed protein product [Vitis vinifera] 166 2e-39 ref|XP_002520874.1| pentatricopeptide repeat-containing protein,... 159 2e-37 ref|XP_002319343.1| predicted protein [Populus trichocarpa] gi|2... 159 3e-37 ref|NP_181604.1| pentatricopeptide repeat-containing protein [Ar... 158 4e-37 >ref|XP_002275344.2| PREDICTED: pentatricopeptide repeat-containing protein At2g40720 [Vitis vinifera] Length = 836 Score = 166 bits (419), Expect = 2e-39 Identities = 79/115 (68%), Positives = 97/115 (84%), Gaps = 1/115 (0%) Frame = +2 Query: 2 SGISPDDVTFLSLISSCNHSGLVDEGLNMFELMR-EYRIEPRMEHYVNMVDLLGRAGLLD 178 S +PD+VTFL+LI+SC+HSG+V+EGLN+F+LMR EY +EPRMEHY ++VDLLGRAG LD Sbjct: 642 SETAPDEVTFLALITSCSHSGMVEEGLNLFQLMRIEYGVEPRMEHYASVVDLLGRAGRLD 701 Query: 179 YAYGFIQKMHIEADRRVWLCLLSACRVHRKLELGELAAHNLLKMDPTRGSNHIQL 343 AY FI+ M I+ADR VWLCLL ACR HR +ELGEL A NLLKM+P RGSN++ L Sbjct: 702 DAYSFIRGMPIDADRSVWLCLLFACRAHRNMELGELVADNLLKMEPARGSNYVPL 756 >emb|CBI25349.3| unnamed protein product [Vitis vinifera] Length = 1241 Score = 166 bits (419), Expect = 2e-39 Identities = 79/115 (68%), Positives = 97/115 (84%), Gaps = 1/115 (0%) Frame = +2 Query: 2 SGISPDDVTFLSLISSCNHSGLVDEGLNMFELMR-EYRIEPRMEHYVNMVDLLGRAGLLD 178 S +PD+VTFL+LI+SC+HSG+V+EGLN+F+LMR EY +EPRMEHY ++VDLLGRAG LD Sbjct: 1047 SETAPDEVTFLALITSCSHSGMVEEGLNLFQLMRIEYGVEPRMEHYASVVDLLGRAGRLD 1106 Query: 179 YAYGFIQKMHIEADRRVWLCLLSACRVHRKLELGELAAHNLLKMDPTRGSNHIQL 343 AY FI+ M I+ADR VWLCLL ACR HR +ELGEL A NLLKM+P RGSN++ L Sbjct: 1107 DAYSFIRGMPIDADRSVWLCLLFACRAHRNMELGELVADNLLKMEPARGSNYVPL 1161 >ref|XP_002520874.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540005|gb|EEF41583.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 833 Score = 159 bits (402), Expect = 2e-37 Identities = 72/115 (62%), Positives = 96/115 (83%), Gaps = 1/115 (0%) Frame = +2 Query: 2 SGISPDDVTFLSLISSCNHSGLVDEGLNMFELMR-EYRIEPRMEHYVNMVDLLGRAGLLD 178 SGI PDDVTFLSL+SSCNHSGL++EGL++FE+M+ ++ IEPRMEHYVN+VDL GRAG L Sbjct: 639 SGIKPDDVTFLSLLSSCNHSGLIEEGLHLFEMMKMKFGIEPRMEHYVNIVDLYGRAGCLG 698 Query: 179 YAYGFIQKMHIEADRRVWLCLLSACRVHRKLELGELAAHNLLKMDPTRGSNHIQL 343 AY F++ M +E DR +WL LL +C++H LELGE+ A+ LL M+P++GSN++QL Sbjct: 699 DAYSFVKNMPVEPDRSIWLSLLCSCKIHLNLELGEMVANKLLNMEPSKGSNYVQL 753 >ref|XP_002319343.1| predicted protein [Populus trichocarpa] gi|222857719|gb|EEE95266.1| predicted protein [Populus trichocarpa] Length = 848 Score = 159 bits (401), Expect = 3e-37 Identities = 72/114 (63%), Positives = 95/114 (83%), Gaps = 1/114 (0%) Frame = +2 Query: 5 GISPDDVTFLSLISSCNHSGLVDEGLNMFELMR-EYRIEPRMEHYVNMVDLLGRAGLLDY 181 GI+PDD+TF+SL++SCNH G ++EGL +F+LM E+ IEPRMEHYVN+VDLLGRAG LD Sbjct: 655 GIAPDDITFISLLTSCNHCGFIEEGLKLFQLMTVEHGIEPRMEHYVNIVDLLGRAGRLDD 714 Query: 182 AYGFIQKMHIEADRRVWLCLLSACRVHRKLELGELAAHNLLKMDPTRGSNHIQL 343 AY F++ + IE DR +WL LL +CRVH +ELG+LAAH LL ++P+RGSN++QL Sbjct: 715 AYAFVKNLPIEPDRSIWLSLLCSCRVHHNVELGKLAAHKLLDIEPSRGSNYVQL 768 >ref|NP_181604.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75276036|sp|Q7XJN6.1|PP197_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g40720 gi|330254774|gb|AEC09868.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 860 Score = 158 bits (400), Expect = 4e-37 Identities = 77/115 (66%), Positives = 92/115 (80%), Gaps = 1/115 (0%) Frame = +2 Query: 2 SGISPDDVTFLSLISSCNHSGLVDEGLNMFELMRE-YRIEPRMEHYVNMVDLLGRAGLLD 178 +G SPDDVTFLSLIS+CNHSG V+EG N+FE M++ Y IEP MEHY NMVDLLGRAGLL+ Sbjct: 672 AGESPDDVTFLSLISACNHSGFVEEGKNIFEFMKQDYGIEPNMEHYANMVDLLGRAGLLE 731 Query: 179 YAYGFIQKMHIEADRRVWLCLLSACRVHRKLELGELAAHNLLKMDPTRGSNHIQL 343 AY FI+ M IEAD +WLCLLSA R H +ELG L+A LL+M+P RGS ++QL Sbjct: 732 EAYSFIKAMPIEADSSIWLCLLSASRTHHNVELGILSAEKLLRMEPERGSTYVQL 786