BLASTX nr result
ID: Cephaelis21_contig00052086
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00052086 (346 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001234561.1| auxin-regulated dual specificity cytosolic k... 123 1e-26 ref|XP_002521318.1| Protein kinase APK1B, chloroplast precursor,... 122 3e-26 ref|XP_002277991.1| PREDICTED: serine/threonine-protein kinase A... 121 5e-26 ref|XP_002331176.1| predicted protein [Populus trichocarpa] gi|2... 120 9e-26 gb|AAP03880.2| Avr9/Cf-9 induced kinase 1 [Nicotiana tabacum] 120 9e-26 >ref|NP_001234561.1| auxin-regulated dual specificity cytosolic kinase [Solanum lycopersicum] gi|14484938|gb|AAK62821.1|AF332960_1 auxin-regulated dual specificity cytosolic kinase [Solanum lycopersicum] gi|270303597|gb|ACZ71039.1| auxin-regulated dual specificity cytosolic kinase [Solanum lycopersicum] Length = 464 Score = 123 bits (309), Expect = 1e-26 Identities = 61/67 (91%), Positives = 62/67 (92%) Frame = +1 Query: 1 EHRLLVYEYMARGNLENQLFRRYSIALPWLTRIKIAVGAAKGLAFLHGEEKPVIYRDFKA 180 E RLLVYEYMARGNLE+QLF RYS LPWLTRIKI VGAAKGLAFLHGEEKPVIYRDFKA Sbjct: 159 EQRLLVYEYMARGNLEDQLFSRYSSCLPWLTRIKIMVGAAKGLAFLHGEEKPVIYRDFKA 218 Query: 181 SNILLDS 201 SNILLDS Sbjct: 219 SNILLDS 225 >ref|XP_002521318.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus communis] gi|223539396|gb|EEF40986.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus communis] Length = 455 Score = 122 bits (306), Expect = 3e-26 Identities = 58/67 (86%), Positives = 63/67 (94%) Frame = +1 Query: 1 EHRLLVYEYMARGNLENQLFRRYSIALPWLTRIKIAVGAAKGLAFLHGEEKPVIYRDFKA 180 EHRLLVYEYM RGNLEN LF+RYS ALPWLTR+KIA+GAAKGLAFLH EEKPVIYRDFKA Sbjct: 151 EHRLLVYEYMERGNLENLLFKRYSAALPWLTRLKIALGAAKGLAFLHEEEKPVIYRDFKA 210 Query: 181 SNILLDS 201 SN+LLD+ Sbjct: 211 SNVLLDA 217 >ref|XP_002277991.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Vitis vinifera] gi|297738561|emb|CBI27806.3| unnamed protein product [Vitis vinifera] Length = 442 Score = 121 bits (304), Expect = 5e-26 Identities = 59/71 (83%), Positives = 64/71 (90%) Frame = +1 Query: 1 EHRLLVYEYMARGNLENQLFRRYSIALPWLTRIKIAVGAAKGLAFLHGEEKPVIYRDFKA 180 EHRLLVYEYM RG+LENQLFRRYS++LPW TR+KIA+GAAKGLAFLH EKPVIYRDFKA Sbjct: 154 EHRLLVYEYMPRGSLENQLFRRYSVSLPWSTRMKIALGAAKGLAFLHEAEKPVIYRDFKA 213 Query: 181 SNILLDSVSYP 213 SNILLDS P Sbjct: 214 SNILLDSDHTP 224 >ref|XP_002331176.1| predicted protein [Populus trichocarpa] gi|222873297|gb|EEF10428.1| predicted protein [Populus trichocarpa] Length = 368 Score = 120 bits (302), Expect = 9e-26 Identities = 58/67 (86%), Positives = 63/67 (94%) Frame = +1 Query: 1 EHRLLVYEYMARGNLENQLFRRYSIALPWLTRIKIAVGAAKGLAFLHGEEKPVIYRDFKA 180 EHRLLVYEY+ RGNLE++LF RYS ALPWLTR+KIAVGAAKGLAFLH EEKPVIYRDFKA Sbjct: 146 EHRLLVYEYVERGNLEDKLFYRYSAALPWLTRLKIAVGAAKGLAFLHEEEKPVIYRDFKA 205 Query: 181 SNILLDS 201 SN+LLDS Sbjct: 206 SNVLLDS 212 >gb|AAP03880.2| Avr9/Cf-9 induced kinase 1 [Nicotiana tabacum] Length = 442 Score = 120 bits (302), Expect = 9e-26 Identities = 58/67 (86%), Positives = 62/67 (92%) Frame = +1 Query: 1 EHRLLVYEYMARGNLENQLFRRYSIALPWLTRIKIAVGAAKGLAFLHGEEKPVIYRDFKA 180 EHRLL YEYM RG+LENQLFRRYS++LPW TR+KIAVGAAKGLAFLH EKPVIYRDFKA Sbjct: 149 EHRLLAYEYMPRGSLENQLFRRYSVSLPWSTRMKIAVGAAKGLAFLHEAEKPVIYRDFKA 208 Query: 181 SNILLDS 201 SNILLDS Sbjct: 209 SNILLDS 215