BLASTX nr result
ID: Cephaelis21_contig00052028
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00052028 (261 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF37726.1|AF237957_1 LMW heat shock protein [Euphorbia esula] 58 9e-07 ref|XP_002510952.1| heat-shock protein, putative [Ricinus commun... 55 8e-06 >gb|AAF37726.1|AF237957_1 LMW heat shock protein [Euphorbia esula] Length = 204 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/59 (45%), Positives = 38/59 (64%) Frame = -2 Query: 260 EVKAEYGNLYITGKGRKECPLETAGRGYSGQIEFPNHSFREKDMKHELKNGVLRVFIPK 84 +V E L I G+G KE E +GR YSG+I+ P F+ ++K E+KNGVL+V +PK Sbjct: 131 KVSVEKNTLIIKGEGEKESEDEESGRKYSGRIDLPEKMFKTDEIKAEMKNGVLKVVVPK 189 >ref|XP_002510952.1| heat-shock protein, putative [Ricinus communis] gi|223550067|gb|EEF51554.1| heat-shock protein, putative [Ricinus communis] Length = 203 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/59 (44%), Positives = 37/59 (62%) Frame = -2 Query: 260 EVKAEYGNLYITGKGRKECPLETAGRGYSGQIEFPNHSFREKDMKHELKNGVLRVFIPK 84 +V E L I G+G KE E +GR Y+G+I+ P +R +K E+KNGVL+V +PK Sbjct: 130 KVTVEQNTLIIKGEGGKESEDEESGRRYAGRIDLPEKIYRTDQIKAEMKNGVLKVVVPK 188