BLASTX nr result
ID: Cephaelis21_contig00051335
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00051335 (529 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282068.2| PREDICTED: B3 domain-containing protein Os01... 108 4e-22 emb|CBI32429.3| unnamed protein product [Vitis vinifera] 107 8e-22 emb|CAN67499.1| hypothetical protein VITISV_019679 [Vitis vinifera] 107 1e-21 ref|XP_002459887.1| hypothetical protein SORBIDRAFT_02g013060 [S... 104 7e-21 ref|XP_004140693.1| PREDICTED: B3 domain-containing protein Os01... 103 2e-20 >ref|XP_002282068.2| PREDICTED: B3 domain-containing protein Os01g0234100-like [Vitis vinifera] Length = 463 Score = 108 bits (271), Expect = 4e-22 Identities = 58/147 (39%), Positives = 91/147 (61%), Gaps = 5/147 (3%) Frame = -2 Query: 426 QRFETLKKLLDMEESPPALWIRATQQRVIAKKI----RQPGSCKR-RMEPLHNACRHQVQ 262 QR +K+ + + P + + I K++ ++ SCKR R++ H ++ + Sbjct: 20 QRTSEMKRKPSAKRTCPEMKRHLDHTQKIKKEVSDAQQKATSCKRIRVDTDHITNGNEAK 79 Query: 261 ATLSVMQRAEAVQENLDAKLPSFVKPMIRSNVTKGFWLSLPKLFCHLHLSSHDTTIVLED 82 + SVM+RAE VQ NL +++PS +K M+ S+VT GFWL LPK FC +HL +DTTI+L D Sbjct: 80 S--SVMERAEKVQRNLPSEIPSMIKSMLPSHVTGGFWLGLPKKFCDVHLPKYDTTIILVD 137 Query: 81 EHNRQYRTRYLAARRGLSAGWMGFAIA 1 + +Y+T++L + GLS GW GF+IA Sbjct: 138 KRGAEYKTKFLVGKTGLSGGWRGFSIA 164 >emb|CBI32429.3| unnamed protein product [Vitis vinifera] Length = 363 Score = 107 bits (268), Expect = 8e-22 Identities = 52/106 (49%), Positives = 75/106 (70%), Gaps = 1/106 (0%) Frame = -2 Query: 315 SCKR-RMEPLHNACRHQVQATLSVMQRAEAVQENLDAKLPSFVKPMIRSNVTKGFWLSLP 139 SCKR R++ H ++ ++ SVM+RAE VQ NL +++PS +K M+ S+VT GFWL LP Sbjct: 3 SCKRIRVDTDHITNGNEAKS--SVMERAEKVQRNLPSEIPSMIKSMLPSHVTGGFWLGLP 60 Query: 138 KLFCHLHLSSHDTTIVLEDEHNRQYRTRYLAARRGLSAGWMGFAIA 1 K FC +HL +DTTI+L D+ +Y+T++L + GLS GW GF+IA Sbjct: 61 KKFCDVHLPKYDTTIILVDKRGAEYKTKFLVGKTGLSGGWRGFSIA 106 >emb|CAN67499.1| hypothetical protein VITISV_019679 [Vitis vinifera] Length = 930 Score = 107 bits (266), Expect = 1e-21 Identities = 51/106 (48%), Positives = 75/106 (70%), Gaps = 1/106 (0%) Frame = -2 Query: 315 SCKR-RMEPLHNACRHQVQATLSVMQRAEAVQENLDAKLPSFVKPMIRSNVTKGFWLSLP 139 SCKR R++ H ++ ++ SVM+RAE VQ NL +++PS +K M+ S+VT GFWL LP Sbjct: 212 SCKRIRVDTDHITNGNEAKS--SVMERAEKVQRNLPSEIPSMIKSMLPSHVTGGFWLGLP 269 Query: 138 KLFCHLHLSSHDTTIVLEDEHNRQYRTRYLAARRGLSAGWMGFAIA 1 K FC +H+ +DTTI+L D+ +Y+T++L + GLS GW GF+IA Sbjct: 270 KKFCDVHMPKYDTTIILVDKRGAEYKTKFLVGKTGLSGGWRGFSIA 315 Score = 95.1 bits (235), Expect = 6e-18 Identities = 44/87 (50%), Positives = 57/87 (65%) Frame = -2 Query: 264 QATLSVMQRAEAVQENLDAKLPSFVKPMIRSNVTKGFWLSLPKLFCHLHLSSHDTTIVLE 85 +A + ++RAE +Q L+ PSFVKPM++S+VT GFWL LP FC +HL HD I L Sbjct: 745 EARVYAVERAEELQSGLETDFPSFVKPMLQSHVTGGFWLGLPVHFCKMHLPKHDEMISLV 804 Query: 84 DEHNRQYRTRYLAARRGLSAGWMGFAI 4 DE + +YLA + GLS GW GFAI Sbjct: 805 DEDGNESPVKYLAEKTGLSGGWRGFAI 831 Score = 87.0 bits (214), Expect = 2e-15 Identities = 38/82 (46%), Positives = 55/82 (67%) Frame = -2 Query: 249 VMQRAEAVQENLDAKLPSFVKPMIRSNVTKGFWLSLPKLFCHLHLSSHDTTIVLEDEHNR 70 +M++A+ + + ++LPS + M RSNV KGFW+ P+ FC LHL +D TI+LEDE Sbjct: 22 LMEQAKKIIADHGSELPSLTRTMSRSNVAKGFWMYFPRSFCKLHLPENDATIILEDEAGE 81 Query: 69 QYRTRYLAARRGLSAGWMGFAI 4 +Y T +L R GLSAGW F++ Sbjct: 82 EYETNFLVNRSGLSAGWRKFSL 103 >ref|XP_002459887.1| hypothetical protein SORBIDRAFT_02g013060 [Sorghum bicolor] gi|241923264|gb|EER96408.1| hypothetical protein SORBIDRAFT_02g013060 [Sorghum bicolor] Length = 447 Score = 104 bits (260), Expect = 7e-21 Identities = 55/116 (47%), Positives = 73/116 (62%) Frame = -2 Query: 351 QRVIAKKIRQPGSCKRRMEPLHNACRHQVQATLSVMQRAEAVQENLDAKLPSFVKPMIRS 172 +RV KK + PG + + ++A H + S + RAE +Q NL A+ PS VK M+RS Sbjct: 66 RRVGPKKRKLPGVPQTQG---YDANGHHISVRESAVARAEEIQSNLPAEHPSIVKHMLRS 122 Query: 171 NVTKGFWLSLPKLFCHLHLSSHDTTIVLEDEHNRQYRTRYLAARRGLSAGWMGFAI 4 +V KGFWL LPK FC HL + D IVLEDE+ + T YL ++G+SAGW GFAI Sbjct: 123 HVVKGFWLGLPKHFCDKHLPNRDVGIVLEDENGEDHHTTYLGYKQGISAGWRGFAI 178 >ref|XP_004140693.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Cucumis sativus] gi|449519168|ref|XP_004166607.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Cucumis sativus] Length = 220 Score = 103 bits (256), Expect = 2e-20 Identities = 51/105 (48%), Positives = 70/105 (66%), Gaps = 3/105 (2%) Frame = -2 Query: 306 RRMEPLH---NACRHQVQATLSVMQRAEAVQENLDAKLPSFVKPMIRSNVTKGFWLSLPK 136 RR++P ++ H ++A VM RA+ VQ L + PS +K M+ S+VT GFWL LPK Sbjct: 40 RRVKPKRTTVDSLYHDLEAQSVVMARAKEVQAKLSPRNPSLIKVMLPSHVTGGFWLGLPK 99 Query: 135 LFCHLHLSSHDTTIVLEDEHNRQYRTRYLAARRGLSAGWMGFAIA 1 FC +HL DT +VLEDE+ + Y T+YL+ + GLSAGW GF+IA Sbjct: 100 GFCDIHLPKQDTAMVLEDENGKLYETKYLSDKTGLSAGWRGFSIA 144