BLASTX nr result
ID: Cephaelis21_contig00051185
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00051185 (379 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631544.1| PREDICTED: LOW QUALITY PROTEIN: putative ami... 62 5e-08 ref|XP_002277441.2| PREDICTED: putative amidase C869.01-like [Vi... 62 5e-08 ref|XP_003631572.1| PREDICTED: putative amidase C869.01-like iso... 62 5e-08 emb|CBI37909.3| unnamed protein product [Vitis vinifera] 62 5e-08 emb|CBI37908.3| unnamed protein product [Vitis vinifera] 62 5e-08 >ref|XP_003631544.1| PREDICTED: LOW QUALITY PROTEIN: putative amidase C869.01-like [Vitis vinifera] Length = 506 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -2 Query: 378 CFGGLKGSEPKLIEVAYAFEQATKIRKPP 292 CFGGLKGSEPKLIE+AY+FEQATKIRKPP Sbjct: 474 CFGGLKGSEPKLIEIAYSFEQATKIRKPP 502 >ref|XP_002277441.2| PREDICTED: putative amidase C869.01-like [Vitis vinifera] Length = 503 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -2 Query: 378 CFGGLKGSEPKLIEVAYAFEQATKIRKPP 292 CFGGLKGSEPKLIE+AY+FEQATKIRKPP Sbjct: 471 CFGGLKGSEPKLIEIAYSFEQATKIRKPP 499 >ref|XP_003631572.1| PREDICTED: putative amidase C869.01-like isoform 2 [Vitis vinifera] Length = 509 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -2 Query: 378 CFGGLKGSEPKLIEVAYAFEQATKIRKPP 292 CFGGLKGSEPKLIE+AY+FEQATKIRKPP Sbjct: 477 CFGGLKGSEPKLIEIAYSFEQATKIRKPP 505 >emb|CBI37909.3| unnamed protein product [Vitis vinifera] Length = 988 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -2 Query: 378 CFGGLKGSEPKLIEVAYAFEQATKIRKPP 292 CFGGLKGSEPKLIE+AY+FEQATKIRKPP Sbjct: 956 CFGGLKGSEPKLIEIAYSFEQATKIRKPP 984 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 378 CFGGLKGSEPKLIEVAYAFEQATKIRKPPPS 286 CFGGLKG EPKLIEVAY FEQATKIR+PP S Sbjct: 475 CFGGLKGMEPKLIEVAYGFEQATKIRRPPAS 505 >emb|CBI37908.3| unnamed protein product [Vitis vinifera] Length = 433 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -2 Query: 378 CFGGLKGSEPKLIEVAYAFEQATKIRKPP 292 CFGGLKGSEPKLIE+AY+FEQATKIRKPP Sbjct: 401 CFGGLKGSEPKLIEIAYSFEQATKIRKPP 429