BLASTX nr result
ID: Cephaelis21_contig00049491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00049491 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006291825.1| orf57 gene product (mitochondrion) [Daucus c... 58 7e-07 >ref|YP_006291825.1| orf57 gene product (mitochondrion) [Daucus carota subsp. sativus] gi|374082010|gb|AEY81202.1| orf57 (mitochondrion) [Daucus carota subsp. sativus] Length = 122 Score = 58.2 bits (139), Expect = 7e-07 Identities = 30/80 (37%), Positives = 47/80 (58%), Gaps = 2/80 (2%) Frame = -1 Query: 235 LIWNVRGIGNKASKRRLRKLCSMHNFSILVLIEPFVSADHAPKLRSFFPFNGFLALD--N 62 L+WN+RGIGN S+RR+ KL M+N S++ ++EP A+ + + FN LA + Sbjct: 5 LLWNIRGIGNIKSRRRVGKLVKMYNISLIAILEPLHHANKIQEFSNRIRFNFSLANQEAD 64 Query: 61 NKIWVLWRSSLVCVQVASSE 2 +KIW+ W + V V + E Sbjct: 65 DKIWLCWNHEVHVVLVDAFE 84