BLASTX nr result
ID: Cephaelis21_contig00049274
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00049274 (307 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAR13301.1| anthocyanin acyltransferase [Phaseolus vulgaris] 105 3e-21 ref|XP_002326108.1| predicted protein [Populus trichocarpa] gi|2... 103 1e-20 ref|XP_002336610.1| predicted protein [Populus trichocarpa] gi|2... 102 3e-20 ref|XP_003531870.1| PREDICTED: anthocyanin 5-aromatic acyltransf... 102 4e-20 ref|XP_002513167.1| Anthocyanin 5-aromatic acyltransferase, puta... 102 4e-20 >gb|AAR13301.1| anthocyanin acyltransferase [Phaseolus vulgaris] Length = 467 Score = 105 bits (263), Expect = 3e-21 Identities = 49/87 (56%), Positives = 64/87 (73%), Gaps = 3/87 (3%) Frame = +1 Query: 55 SNTLKVMEHCHISPPQGSVSSTILPLTFFDIPWLIFSPSQPLFFYDFPH---HLKQDILA 225 ++TLKV+E C +SPP GSV ST +PLTFFD+PWL P + +FFY+FP+ H Q +L Sbjct: 2 ADTLKVIEQCEVSPPPGSVPSTSIPLTFFDLPWLCCPPLKRIFFYNFPYSTQHFFQTLLP 61 Query: 226 NLKRSLSITLQHFFILAGNLVVPPQPS 306 LK SLS+TLQHFF + NLV PP+P+ Sbjct: 62 TLKNSLSLTLQHFFPFSSNLVFPPKPN 88 >ref|XP_002326108.1| predicted protein [Populus trichocarpa] gi|222862983|gb|EEF00490.1| predicted protein [Populus trichocarpa] Length = 445 Score = 103 bits (258), Expect = 1e-20 Identities = 50/89 (56%), Positives = 65/89 (73%), Gaps = 3/89 (3%) Frame = +1 Query: 46 MASSNTLKVMEHCHISPPQGSVSSTILPLTFFDIPWLIFSPSQPLFFYDFPH---HLKQD 216 MA S+ +K+++H +SPP GSV +T LPLTFFD PWL+ P + LFFY+FP+ +L + Sbjct: 1 MAHSHPVKLIDHFRVSPPLGSVPTTSLPLTFFDFPWLLCRPMERLFFYEFPYPTLYLTNN 60 Query: 217 ILANLKRSLSITLQHFFILAGNLVVPPQP 303 IL LK SLS+TLQHFF LA NL+ PP P Sbjct: 61 ILPILKNSLSLTLQHFFPLASNLMCPPSP 89 >ref|XP_002336610.1| predicted protein [Populus trichocarpa] gi|222836314|gb|EEE74735.1| predicted protein [Populus trichocarpa] Length = 467 Score = 102 bits (254), Expect = 3e-20 Identities = 49/89 (55%), Positives = 64/89 (71%), Gaps = 3/89 (3%) Frame = +1 Query: 46 MASSNTLKVMEHCHISPPQGSVSSTILPLTFFDIPWLIFSPSQPLFFYDFPH---HLKQD 216 MA S+++KV++ +SPP GSV +T LPLTFFD PWL+ P + LFFY+FP+ + + Sbjct: 1 MAQSHSVKVIDRVQVSPPPGSVPTTSLPLTFFDFPWLLCRPMERLFFYEFPYPTLYFTNN 60 Query: 217 ILANLKRSLSITLQHFFILAGNLVVPPQP 303 IL LK SLS+TLQHFF LA NL+ PP P Sbjct: 61 ILPILKNSLSLTLQHFFPLASNLMCPPSP 89 >ref|XP_003531870.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Glycine max] Length = 469 Score = 102 bits (253), Expect = 4e-20 Identities = 46/90 (51%), Positives = 65/90 (72%), Gaps = 3/90 (3%) Frame = +1 Query: 46 MASSNTLKVMEHCHISPPQGSVSSTILPLTFFDIPWLIFSPSQPLFFYDFPH---HLKQD 216 MA + T+KV+E C + PP G+V ST +PLTF+D+PWL P + +FF++FP+ H Q Sbjct: 1 MADTVTVKVIEQCEVGPPPGTVPSTSIPLTFYDLPWLCCPPLKRIFFFNFPYSSQHFLQT 60 Query: 217 ILANLKRSLSITLQHFFILAGNLVVPPQPS 306 +L +LK SLS+TLQHFF + NLV PP+P+ Sbjct: 61 LLPSLKHSLSLTLQHFFPFSSNLVFPPKPN 90 >ref|XP_002513167.1| Anthocyanin 5-aromatic acyltransferase, putative [Ricinus communis] gi|223547665|gb|EEF49158.1| Anthocyanin 5-aromatic acyltransferase, putative [Ricinus communis] Length = 464 Score = 102 bits (253), Expect = 4e-20 Identities = 51/85 (60%), Positives = 57/85 (67%), Gaps = 3/85 (3%) Frame = +1 Query: 46 MASSNTLKVMEHCHISPPQGSVSSTILPLTFFDIPWLIFSPSQPLFFYDFPH---HLKQD 216 MA +T+KV+EH ISP S ST LPLTFFD+PWL FSP QPLFFY +PH H Sbjct: 1 MAKPSTIKVLEHSKISPSPNSSPSTTLPLTFFDLPWLFFSPCQPLFFYAYPHSTSHFLSS 60 Query: 217 ILANLKRSLSITLQHFFILAGNLVV 291 L NLK SLS+ LQ FF GNLVV Sbjct: 61 TLPNLKHSLSLALQEFFPFLGNLVV 85