BLASTX nr result
ID: Cephaelis21_contig00048812
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00048812 (412 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264471.2| PREDICTED: trehalose-phosphate phosphatase-l... 57 2e-06 ref|XP_003631447.1| PREDICTED: trehalose-phosphate phosphatase-l... 57 2e-06 >ref|XP_002264471.2| PREDICTED: trehalose-phosphate phosphatase-like [Vitis vinifera] Length = 393 Score = 57.0 bits (136), Expect = 2e-06 Identities = 32/49 (65%), Positives = 38/49 (77%), Gaps = 2/49 (4%) Frame = +3 Query: 270 MDLKSSKASPVLTDPAPMDKSRLGI-RGLLPCAQSGPSFST-SVLAIPR 410 MDLKS+ ASPVLTDPAP++KSRLGI GLLP +Q G FS+ + IPR Sbjct: 1 MDLKSNHASPVLTDPAPVNKSRLGIPSGLLPYSQPGTGFSSGKYVIIPR 49 >ref|XP_003631447.1| PREDICTED: trehalose-phosphate phosphatase-like [Vitis vinifera] Length = 393 Score = 57.0 bits (136), Expect = 2e-06 Identities = 32/49 (65%), Positives = 38/49 (77%), Gaps = 2/49 (4%) Frame = +3 Query: 270 MDLKSSKASPVLTDPAPMDKSRLGI-RGLLPCAQSGPSFST-SVLAIPR 410 MDLKS+ ASPVLTDPAP++KSRLGI GLLP +Q G FS+ + IPR Sbjct: 1 MDLKSNHASPVLTDPAPVNKSRLGIPSGLLPYSQPGTGFSSGKYVIIPR 49