BLASTX nr result
ID: Cephaelis21_contig00048665
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00048665 (296 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA65996.1| hypothetical protein [Beta vulgaris subsp. vulga... 56 3e-06 >emb|CCA65996.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 744 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/76 (32%), Positives = 42/76 (55%), Gaps = 3/76 (3%) Frame = +2 Query: 56 WLVEGHAMRIFKWNPDFHIEKESSLFPS---WISLPRLPLHFFNRMALFGMMSLIGNPLR 226 W + H + + +W PDF S+F WI P LPL ++++ ALF + +G P++ Sbjct: 183 WFILNHYLMLTRWKPDFR--PSQSVFDKIMVWIRFPELPLEYYDKEALFAIAGKVGKPIK 240 Query: 227 IDTATATLSRPSLAKV 274 +D AT ++R A+V Sbjct: 241 VDYATDHMARGRYARV 256