BLASTX nr result
ID: Cephaelis21_contig00048518
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00048518 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284727.1| PREDICTED: uncharacterized protein LOC100252... 80 7e-14 emb|CBI18940.3| unnamed protein product [Vitis vinifera] 80 7e-14 ref|XP_002520272.1| conserved hypothetical protein [Ricinus comm... 76 1e-13 emb|CAN81476.1| hypothetical protein VITISV_000606 [Vitis vinifera] 80 2e-13 ref|XP_002302208.1| predicted protein [Populus trichocarpa] gi|2... 76 1e-12 >ref|XP_002284727.1| PREDICTED: uncharacterized protein LOC100252353 [Vitis vinifera] Length = 251 Score = 79.7 bits (195), Expect(2) = 7e-14 Identities = 36/48 (75%), Positives = 40/48 (83%) Frame = +2 Query: 164 GKETDTFNRIVPRKYTLSHCDFTAKLTLTISNTIRLDQLRGWYNKDDV 307 G+E D ++ I PR YTLSHCDFTA LTLTISN I LDQL+GWYNKDDV Sbjct: 74 GEEIDNYSGISPRVYTLSHCDFTANLTLTISNIISLDQLKGWYNKDDV 121 Score = 21.9 bits (45), Expect(2) = 7e-14 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 108 VRLSSFSDRRLQYNTLVFQEKR 173 V LSS + YN LVF+ R Sbjct: 34 VVLSSIGSTKASYNALVFEAAR 55 >emb|CBI18940.3| unnamed protein product [Vitis vinifera] Length = 232 Score = 79.7 bits (195), Expect(2) = 7e-14 Identities = 36/48 (75%), Positives = 40/48 (83%) Frame = +2 Query: 164 GKETDTFNRIVPRKYTLSHCDFTAKLTLTISNTIRLDQLRGWYNKDDV 307 G+E D ++ I PR YTLSHCDFTA LTLTISN I LDQL+GWYNKDDV Sbjct: 55 GEEIDNYSGISPRVYTLSHCDFTANLTLTISNIISLDQLKGWYNKDDV 102 Score = 21.9 bits (45), Expect(2) = 7e-14 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 108 VRLSSFSDRRLQYNTLVFQEKR 173 V LSS + YN LVF+ R Sbjct: 15 VVLSSIGSTKASYNALVFEAAR 36 >ref|XP_002520272.1| conserved hypothetical protein [Ricinus communis] gi|223540491|gb|EEF42058.1| conserved hypothetical protein [Ricinus communis] Length = 249 Score = 76.3 bits (186), Expect(2) = 1e-13 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = +2 Query: 176 DTFNRIVPRKYTLSHCDFTAKLTLTISNTIRLDQLRGWYNKDDV 307 D N I+PR Y LSHCDFTA+LTLTISN I LDQLRGWY+KDDV Sbjct: 75 DQINDIIPRTYILSHCDFTAELTLTISNVINLDQLRGWYSKDDV 118 Score = 24.6 bits (52), Expect(2) = 1e-13 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 87 FKPQIPSVRLSSFSDRRLQYNTLVFQEKRQIL 182 FK P+V + S ++R +NTLV + R ++ Sbjct: 27 FKRSRPAVVICSITNRSANFNTLVSEAVRHLV 58 >emb|CAN81476.1| hypothetical protein VITISV_000606 [Vitis vinifera] Length = 208 Score = 79.7 bits (195), Expect = 2e-13 Identities = 36/48 (75%), Positives = 40/48 (83%) Frame = +2 Query: 164 GKETDTFNRIVPRKYTLSHCDFTAKLTLTISNTIRLDQLRGWYNKDDV 307 G+E D ++ I PR YTLSHCDFTA LTLTISN I LDQL+GWYNKDDV Sbjct: 31 GEEIDNYSGISPRVYTLSHCDFTANLTLTISNIISLDQLKGWYNKDDV 78 >ref|XP_002302208.1| predicted protein [Populus trichocarpa] gi|222843934|gb|EEE81481.1| predicted protein [Populus trichocarpa] Length = 222 Score = 76.3 bits (186), Expect(2) = 1e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +2 Query: 158 LSGKETDTFNRIVPRKYTLSHCDFTAKLTLTISNTIRLDQLRGWYNKDDV 307 L G+E + ++ I+PR Y LSHCDFTA LTL ISN I LDQLRGWY+KDDV Sbjct: 77 LMGEEMNQYSAIIPRTYILSHCDFTADLTLIISNVINLDQLRGWYSKDDV 126 Score = 21.6 bits (44), Expect(2) = 1e-12 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 114 LSSFSDRRLQYNTLVFQEKR 173 LSS + R YNTLV + R Sbjct: 41 LSSIDNSRASYNTLVSEAVR 60