BLASTX nr result
ID: Cephaelis21_contig00048517
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00048517 (264 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520687.1| conserved hypothetical protein [Ricinus comm... 57 1e-06 >ref|XP_002520687.1| conserved hypothetical protein [Ricinus communis] gi|223540072|gb|EEF41649.1| conserved hypothetical protein [Ricinus communis] Length = 313 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/43 (60%), Positives = 31/43 (72%) Frame = +3 Query: 135 MEEFKKERKASQWWWFDRLSDSNHNQKRSPWLRSTLAELDEKT 263 +E KKE + S WWWFD S+H+ RSPWL+STLAELD KT Sbjct: 2 VEMTKKEMETSHWWWFD----SHHSSLRSPWLQSTLAELDNKT 40