BLASTX nr result
ID: Cephaelis21_contig00048510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00048510 (249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634499.1| PREDICTED: abscisic acid 8'-hydroxylase 3-li... 59 4e-07 emb|CBI18551.3| unnamed protein product [Vitis vinifera] 59 4e-07 ref|XP_004139645.1| PREDICTED: abscisic acid 8'-hydroxylase 3-li... 56 3e-06 ref|XP_002533019.1| cytochrome P450, putative [Ricinus communis]... 55 8e-06 >ref|XP_003634499.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Vitis vinifera] Length = 477 Score = 58.9 bits (141), Expect = 4e-07 Identities = 31/56 (55%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Frame = -2 Query: 167 MELSLLMVFXXXXXXXXXXXXL-QTWASTRAMAEIPGSLGWPIVGETFSFIAEFSS 3 MELS+LM+ L +WAS +AM IPG+LGWPIVGE+FSFI+EFSS Sbjct: 1 MELSMLMILALASVFLLSCFLLLHSWASPKAMETIPGTLGWPIVGESFSFISEFSS 56 >emb|CBI18551.3| unnamed protein product [Vitis vinifera] Length = 471 Score = 58.9 bits (141), Expect = 4e-07 Identities = 31/56 (55%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Frame = -2 Query: 167 MELSLLMVFXXXXXXXXXXXXL-QTWASTRAMAEIPGSLGWPIVGETFSFIAEFSS 3 MELS+LM+ L +WAS +AM IPG+LGWPIVGE+FSFI+EFSS Sbjct: 1 MELSMLMILALASVFLLSCFLLLHSWASPKAMETIPGTLGWPIVGESFSFISEFSS 56 >ref|XP_004139645.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Cucumis sativus] gi|449475452|ref|XP_004154457.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Cucumis sativus] Length = 474 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/55 (47%), Positives = 37/55 (67%) Frame = -2 Query: 167 MELSLLMVFXXXXXXXXXXXXLQTWASTRAMAEIPGSLGWPIVGETFSFIAEFSS 3 M L++L++ +++W +AM EIPG+LGWPIVGE+FSFI+EFSS Sbjct: 1 MALNVLLMLIIVLFVLLAFLFVRSWGWPKAMEEIPGNLGWPIVGESFSFISEFSS 55 >ref|XP_002533019.1| cytochrome P450, putative [Ricinus communis] gi|223527208|gb|EEF29373.1| cytochrome P450, putative [Ricinus communis] Length = 476 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 1/56 (1%) Frame = -2 Query: 167 MELSLLMVFXXXXXXXXXXXXL-QTWASTRAMAEIPGSLGWPIVGETFSFIAEFSS 3 MEL +L++F L W S + M ++PGSLGWPIVGE+FSF++EFSS Sbjct: 1 MELGILLIFALLSILLLSTFLLLHLWISPKEMEDLPGSLGWPIVGESFSFLSEFSS 56