BLASTX nr result
ID: Cephaelis21_contig00048502
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00048502 (275 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523980.1| conserved hypothetical protein [Ricinus comm... 71 8e-11 ref|XP_003520379.1| PREDICTED: uncharacterized protein LOC100786... 70 2e-10 ref|XP_004134350.1| PREDICTED: uncharacterized protein LOC101217... 65 6e-09 ref|XP_002271177.2| PREDICTED: uncharacterized protein LOC100252... 64 2e-08 ref|XP_002868445.1| hypothetical protein ARALYDRAFT_355578 [Arab... 64 2e-08 >ref|XP_002523980.1| conserved hypothetical protein [Ricinus communis] gi|223536707|gb|EEF38348.1| conserved hypothetical protein [Ricinus communis] Length = 109 Score = 71.2 bits (173), Expect = 8e-11 Identities = 31/39 (79%), Positives = 38/39 (97%) Frame = +3 Query: 159 MEVELEPRVKPLPFKVKGISRESPAQKAAHVLDTDLRNH 275 ME+ELEPRVKPL +KVKG+SRESP+QKA+H+LDTDLR+H Sbjct: 1 MEIELEPRVKPLSYKVKGMSRESPSQKASHILDTDLRSH 39 >ref|XP_003520379.1| PREDICTED: uncharacterized protein LOC100786119 [Glycine max] Length = 1927 Score = 69.7 bits (169), Expect = 2e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 159 MEVELEPRVKPLPFKVKGISRESPAQKAAHVLDTDLRNH 275 MEVELEPRVK LPFKVK +SRESP+QKA HVLDTDLR H Sbjct: 1 MEVELEPRVKALPFKVKAMSRESPSQKALHVLDTDLRTH 39 >ref|XP_004134350.1| PREDICTED: uncharacterized protein LOC101217878 [Cucumis sativus] Length = 2142 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +3 Query: 159 MEVELEPRVKPLPFKVKGISRESPAQKAAHVLDTDLRNH 275 ME+ELEPRVK L +KVKG+SRESP+QKAA+VLD DLR H Sbjct: 1 MEIELEPRVKALDYKVKGVSRESPSQKAANVLDLDLRTH 39 >ref|XP_002271177.2| PREDICTED: uncharacterized protein LOC100252352 [Vitis vinifera] Length = 2037 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +3 Query: 159 MEVELEPRVKPLPFKVKGISRESPAQKAAHVLDTDLRNH 275 ME+ELEPRVK L +K+K SRESP+QKA HVLDTDLR H Sbjct: 1 MEIELEPRVKTLSYKIKASSRESPSQKAIHVLDTDLRTH 39 >ref|XP_002868445.1| hypothetical protein ARALYDRAFT_355578 [Arabidopsis lyrata subsp. lyrata] gi|297314281|gb|EFH44704.1| hypothetical protein ARALYDRAFT_355578 [Arabidopsis lyrata subsp. lyrata] Length = 2110 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +3 Query: 159 MEVELEPRVKPLPFKVKGISRESPAQKAAHVLDTDLRNH 275 ME ELEPRVKPLPFKVK +SRES +QKAA VL+ DLR+H Sbjct: 1 METELEPRVKPLPFKVKAMSRESSSQKAAQVLEPDLRSH 39