BLASTX nr result
ID: Cephaelis21_contig00048000
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00048000 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316052.1| predicted protein [Populus trichocarpa] gi|2... 63 3e-08 >ref|XP_002316052.1| predicted protein [Populus trichocarpa] gi|222865092|gb|EEF02223.1| predicted protein [Populus trichocarpa] Length = 82 Score = 62.8 bits (151), Expect = 3e-08 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 5/60 (8%) Frame = +3 Query: 12 FRWPDFDFSIPAASVFRWAAGIDISSYFTT-----GFRWLDFSILDNVMWTLVTVLESVS 176 FRWP+F FS+P++S+ RW D SYFTT RWLDF+I D+V+WT VT LESV+ Sbjct: 10 FRWPEFGFSMPSSSILRWPE-FDF-SYFTTRLTLESLRWLDFAI-DDVLWTFVTALESVA 66