BLASTX nr result
ID: Cephaelis21_contig00047811
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00047811 (249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281970.1| PREDICTED: U-box domain-containing protein 2... 88 8e-16 emb|CAN83909.1| hypothetical protein VITISV_035044 [Vitis vinifera] 88 8e-16 ref|XP_002517222.1| E3 ubiquitin ligase PUB14, putative [Ricinus... 85 5e-15 emb|CBI37574.3| unnamed protein product [Vitis vinifera] 83 3e-14 ref|XP_002309886.1| photoperiod-response-like protein [Populus t... 83 3e-14 >ref|XP_002281970.1| PREDICTED: U-box domain-containing protein 27 [Vitis vinifera] Length = 412 Score = 87.8 bits (216), Expect = 8e-16 Identities = 41/72 (56%), Positives = 57/72 (79%), Gaps = 2/72 (2%) Frame = -3 Query: 244 SIQRWLDCGNDTCPATMQVLPTKDFVPNHNLQRLIQIWSESVKTRQTATES--TAINSVT 71 SIQRWLD GN+TCPATMQVL +KDFVPNH LQRLIQIWS SV+ R + +S + S++ Sbjct: 39 SIQRWLDNGNNTCPATMQVLHSKDFVPNHTLQRLIQIWSNSVRHRSNSPDSPIQLVPSLS 98 Query: 70 PAEAKIIVQQLK 35 P +A+ ++++++ Sbjct: 99 PDQARDLIKEIE 110 >emb|CAN83909.1| hypothetical protein VITISV_035044 [Vitis vinifera] Length = 383 Score = 87.8 bits (216), Expect = 8e-16 Identities = 41/72 (56%), Positives = 57/72 (79%), Gaps = 2/72 (2%) Frame = -3 Query: 244 SIQRWLDCGNDTCPATMQVLPTKDFVPNHNLQRLIQIWSESVKTRQTATES--TAINSVT 71 SIQRWLD GN+TCPATMQVL +KDFVPNH LQRLIQIWS SV+ R + +S + S++ Sbjct: 39 SIQRWLDNGNNTCPATMQVLHSKDFVPNHTLQRLIQIWSNSVRHRSNSPDSPIQLVPSLS 98 Query: 70 PAEAKIIVQQLK 35 P +A+ ++++++ Sbjct: 99 PDQARDLIKEIE 110 >ref|XP_002517222.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis] gi|223543593|gb|EEF45122.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis] Length = 412 Score = 85.1 bits (209), Expect = 5e-15 Identities = 45/74 (60%), Positives = 55/74 (74%), Gaps = 4/74 (5%) Frame = -3 Query: 244 SIQRWLDCGNDTCPATMQVLPTKDFVPNHNLQRLIQIWSESVKTRQT--ATESTAINSVT 71 SIQRWLD GN+TCPATMQVL +KDFVPN LQRLIQIWS+SV+ Q+ +S NSV Sbjct: 39 SIQRWLDNGNNTCPATMQVLQSKDFVPNRTLQRLIQIWSDSVEHYQSHRRVDSAVDNSVV 98 Query: 70 PA--EAKIIVQQLK 35 P+ E K IV+ ++ Sbjct: 99 PSQDEIKCIVEDIE 112 >emb|CBI37574.3| unnamed protein product [Vitis vinifera] Length = 271 Score = 82.8 bits (203), Expect = 3e-14 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = -3 Query: 244 SIQRWLDCGNDTCPATMQVLPTKDFVPNHNLQRLIQIWSESVKTRQTATES 92 SIQRWLD GN+TCPATMQVL +KDFVPNH LQRLIQIWS SV+ R + +S Sbjct: 88 SIQRWLDNGNNTCPATMQVLHSKDFVPNHTLQRLIQIWSNSVRHRSNSPDS 138 >ref|XP_002309886.1| photoperiod-response-like protein [Populus trichocarpa] gi|224093344|ref|XP_002309891.1| photoperiod-response-like protein [Populus trichocarpa] gi|222852789|gb|EEE90336.1| photoperiod-response-like protein [Populus trichocarpa] gi|222852794|gb|EEE90341.1| photoperiod-response-like protein [Populus trichocarpa] Length = 414 Score = 82.8 bits (203), Expect = 3e-14 Identities = 38/71 (53%), Positives = 56/71 (78%), Gaps = 1/71 (1%) Frame = -3 Query: 244 SIQRWLDCGNDTCPATMQVLPTKDFVPNHNLQRLIQIWSESVKT-RQTATESTAINSVTP 68 SI+RWLD GN+TCPATMQVL +K+FVPN LQRLI+IWS+SV+T + +S A + VT Sbjct: 40 SIERWLDSGNNTCPATMQVLNSKEFVPNRTLQRLIKIWSDSVQTQKDNRVDSAASSVVTR 99 Query: 67 AEAKIIVQQLK 35 + +++V++++ Sbjct: 100 EDIEVLVKEMR 110