BLASTX nr result
ID: Cephaelis21_contig00047389
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00047389 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527487.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002527487.1| conserved hypothetical protein [Ricinus communis] gi|223533127|gb|EEF34885.1| conserved hypothetical protein [Ricinus communis] Length = 902 Score = 57.0 bits (136), Expect = 2e-06 Identities = 36/89 (40%), Positives = 53/89 (59%) Frame = -2 Query: 287 LDLNEREPSLTKAEELSCDGAHNASKDVGKCPSNDRMQESSLINHCNIQNQRIRNGGKED 108 +D+N+ E SL K + H ++ +MQ SSL N+ I+ + + GG ++ Sbjct: 724 VDMNKEEDSLDK---ILVKPLHRLERE--------KMQASSLRNNHGIRKHQNKLGG-DN 771 Query: 107 TSGFESLDKILVKHVSRLEREKMEFQAKE 21 +G E LDK+LVKHVSRLE+EKM+F KE Sbjct: 772 AAGCEGLDKVLVKHVSRLEKEKMQFILKE 800