BLASTX nr result
ID: Cephaelis21_contig00047164
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00047164 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526851.1| conserved hypothetical protein [Ricinus comm... 58 9e-07 >ref|XP_002526851.1| conserved hypothetical protein [Ricinus communis] gi|223533750|gb|EEF35482.1| conserved hypothetical protein [Ricinus communis] Length = 335 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 3/66 (4%) Frame = -2 Query: 235 TKVKFG-DKTVWVAFRYENLASFCYYCGKVGHIEVNCVDRQRDAREGHVQEG--QYGEWL 65 TK+ G +K +WV FRYE L SFCY CG +GH+ +C R D + E +G+W+ Sbjct: 50 TKIAMGSNKDMWVFFRYERLPSFCYVCGCLGHVMRDCDSRTEDDGYDAMDEKLLPFGDWM 109 Query: 64 KAEGFK 47 +A FK Sbjct: 110 RASPFK 115