BLASTX nr result
ID: Cephaelis21_contig00046757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00046757 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305627.1| predicted protein [Populus trichocarpa] gi|2... 55 5e-06 >ref|XP_002305627.1| predicted protein [Populus trichocarpa] gi|222848591|gb|EEE86138.1| predicted protein [Populus trichocarpa] Length = 273 Score = 55.5 bits (132), Expect = 5e-06 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = -2 Query: 320 VWVKRNGDCLILHFKCPCTKCYQILLLWSNCFYKL 216 V V+++GDC I+HFKCPC K YQILL NC+YK+ Sbjct: 238 VCVEKSGDCFIVHFKCPCGKRYQILLSGGNCYYKI 272