BLASTX nr result
ID: Cephaelis21_contig00046059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00046059 (375 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_564786.1| pentatricopeptide repeat-containing protein [Ar... 50 5e-12 gb|AAM62848.1| putative membrane-associated salt-inducible prote... 50 6e-12 ref|XP_004145104.1| PREDICTED: pentatricopeptide repeat-containi... 53 1e-11 emb|CBI32989.3| unnamed protein product [Vitis vinifera] 49 4e-11 ref|XP_003634851.1| PREDICTED: pentatricopeptide repeat-containi... 49 4e-11 >ref|NP_564786.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|193806489|sp|Q8LE47.2|PPR87_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g61870, mitochondrial; AltName: Full=Protein PENTATRICOPEPTIDE REPEAT 336; Flags: Precursor gi|16226403|gb|AAL16159.1|AF428391_1 At1g61870/F8K4_8 [Arabidopsis thaliana] gi|3367521|gb|AAC28506.1| Similar to gb|U08285 membrane-associated salt-inducible protein from Nicotiana tabacum. ESTs gb|T44131 and gb|T04378 come from this gene [Arabidopsis thaliana] gi|17065564|gb|AAL32936.1| Unknown protein [Arabidopsis thaliana] gi|32815835|gb|AAP88326.1| At1g61870 [Arabidopsis thaliana] gi|332195777|gb|AEE33898.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 408 Score = 49.7 bits (117), Expect(2) = 5e-12 Identities = 25/54 (46%), Positives = 35/54 (64%) Frame = -2 Query: 257 DFEVASSICKDCIARDRVPNFRIMKSPVDGLASIQGLMKRKRLFVNYKEKFSTN 96 DFE A S+CK+ + ++ VP+F IMKS V+GLA + + K L KEKF+ N Sbjct: 342 DFETALSLCKESMEKNWVPSFSIMKSLVNGLAKDSKVEEAKELIGQVKEKFTRN 395 Score = 45.8 bits (107), Expect(2) = 5e-12 Identities = 21/40 (52%), Positives = 27/40 (67%), Gaps = 6/40 (15%) Frame = -3 Query: 361 GFCKEEDLEEAKGDGEI------KPEWQCYFTRVYYLCQG 260 GFC E+D EEAK +I KP+ +CYFT +YYLC+G Sbjct: 301 GFCNEDDFEEAKKLFKIMVNRGCKPDSECYFTLIYYLCKG 340 >gb|AAM62848.1| putative membrane-associated salt-inducible protein [Arabidopsis thaliana] Length = 407 Score = 49.7 bits (117), Expect(2) = 6e-12 Identities = 25/54 (46%), Positives = 35/54 (64%) Frame = -2 Query: 257 DFEVASSICKDCIARDRVPNFRIMKSPVDGLASIQGLMKRKRLFVNYKEKFSTN 96 DFE A S+CK+ + ++ VP+F IMKS V+GLA + + K L KEKF+ N Sbjct: 341 DFETALSLCKESMEKNWVPSFSIMKSLVNGLAKDSKVEEAKELIGQVKEKFTRN 394 Score = 45.4 bits (106), Expect(2) = 6e-12 Identities = 20/40 (50%), Positives = 27/40 (67%), Gaps = 6/40 (15%) Frame = -3 Query: 361 GFCKEEDLEEAKGDGEI------KPEWQCYFTRVYYLCQG 260 GFC E+D EEAK ++ KP+ +CYFT +YYLC+G Sbjct: 300 GFCNEDDFEEAKKLFKVMVNRGCKPDSECYFTLIYYLCKG 339 >ref|XP_004145104.1| PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Cucumis sativus] gi|449471723|ref|XP_004153390.1| PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Cucumis sativus] gi|449530564|ref|XP_004172264.1| PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Cucumis sativus] Length = 405 Score = 52.8 bits (125), Expect(2) = 1e-11 Identities = 29/65 (44%), Positives = 39/65 (60%) Frame = -2 Query: 257 DFEVASSICKDCIARDRVPNFRIMKSPVDGLASIQGLMKRKRLFVNYKEKFSTNSCR*TE 78 D+E A IC + + + VPNF MKS VDGL SI + + K+L KE+FS N + +E Sbjct: 339 DYETAFKICLESMKKGWVPNFSTMKSLVDGLVSISKVEEAKQLIGQIKERFSKNVEKWSE 398 Query: 77 IGEGL 63 I GL Sbjct: 399 IEAGL 403 Score = 41.2 bits (95), Expect(2) = 1e-11 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 6/40 (15%) Frame = -3 Query: 361 GFCKEEDLEEAKG------DGEIKPEWQCYFTRVYYLCQG 260 GFCKE +L+EAK + +P+ +CYFT Y+LC+G Sbjct: 298 GFCKEGNLDEAKSIFKRMINSGCQPDSECYFTLTYFLCRG 337 >emb|CBI32989.3| unnamed protein product [Vitis vinifera] Length = 412 Score = 48.9 bits (115), Expect(2) = 4e-11 Identities = 27/65 (41%), Positives = 35/65 (53%) Frame = -2 Query: 257 DFEVASSICKDCIARDRVPNFRIMKSPVDGLASIQGLMKRKRLFVNYKEKFSTNSCR*TE 78 DFE A CK+C+ + PN M S V+GL SI + + + L KEKFS N + E Sbjct: 346 DFESALRFCKECMEKGWFPNISTMTSLVNGLVSISKVEEARELIGQIKEKFSRNVDKWNE 405 Query: 77 IGEGL 63 I GL Sbjct: 406 IEAGL 410 Score = 43.5 bits (101), Expect(2) = 4e-11 Identities = 21/40 (52%), Positives = 26/40 (65%), Gaps = 6/40 (15%) Frame = -3 Query: 361 GFCKEEDLEEAKG------DGEIKPEWQCYFTRVYYLCQG 260 GFCKE +L+EAK + KP+ CYFT VY+LCQG Sbjct: 305 GFCKEGNLDEAKKLFKDMVNRGCKPDSDCYFTLVYFLCQG 344 >ref|XP_003634851.1| PREDICTED: pentatricopeptide repeat-containing protein At1g61870, mitochondrial-like [Vitis vinifera] Length = 396 Score = 48.9 bits (115), Expect(2) = 4e-11 Identities = 27/65 (41%), Positives = 35/65 (53%) Frame = -2 Query: 257 DFEVASSICKDCIARDRVPNFRIMKSPVDGLASIQGLMKRKRLFVNYKEKFSTNSCR*TE 78 DFE A CK+C+ + PN M S V+GL SI + + + L KEKFS N + E Sbjct: 330 DFESALRFCKECMEKGWFPNISTMTSLVNGLVSISKVEEARELIGQIKEKFSRNVDKWNE 389 Query: 77 IGEGL 63 I GL Sbjct: 390 IEAGL 394 Score = 43.5 bits (101), Expect(2) = 4e-11 Identities = 21/40 (52%), Positives = 26/40 (65%), Gaps = 6/40 (15%) Frame = -3 Query: 361 GFCKEEDLEEAKG------DGEIKPEWQCYFTRVYYLCQG 260 GFCKE +L+EAK + KP+ CYFT VY+LCQG Sbjct: 289 GFCKEGNLDEAKKLFKDMVNRGCKPDSDCYFTLVYFLCQG 328