BLASTX nr result
ID: Cephaelis21_contig00045983
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00045983 (217 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524786.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 gb|AAC63844.1| putative non-LTR retroelement reverse transcripta... 65 7e-09 emb|CAB10337.1| reverse transcriptase like protein [Arabidopsis ... 59 3e-07 emb|CAB78008.1| putative protein [Arabidopsis thaliana] gi|73210... 59 3e-07 gb|AAD37021.1| putative non-LTR retrolelement reverse transcript... 57 1e-06 >ref|XP_002524786.1| conserved hypothetical protein [Ricinus communis] gi|223535970|gb|EEF37629.1| conserved hypothetical protein [Ricinus communis] Length = 105 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/62 (45%), Positives = 46/62 (74%) Frame = -2 Query: 195 QQAIKEKLGFSITTNLGQYLGVPVLHERRSKKTYHELVQKVEAKLNGWKHNQLTFAGRVI 16 ++ + KLG+ +T++LG+YLG+P+LH R +K TY +V K+ +KL GW ++ L+ AGR+ Sbjct: 44 RRILASKLGYEMTSDLGKYLGMPILHGRINKNTYQGIVDKIGSKLAGWSNSCLSLAGRIT 103 Query: 15 LA 10 LA Sbjct: 104 LA 105 >gb|AAC63844.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 1231 Score = 64.7 bits (156), Expect = 7e-09 Identities = 28/65 (43%), Positives = 44/65 (67%) Frame = -2 Query: 195 QQAIKEKLGFSITTNLGQYLGVPVLHERRSKKTYHELVQKVEAKLNGWKHNQLTFAGRVI 16 +Q I E+ G T LG+YLG+P+L +R +K+T+ E++++V A+L GWK L+ AGR+ Sbjct: 595 EQLISEESGIGCTKELGKYLGMPILQKRMNKETFGEVLERVSARLAGWKGRSLSLAGRIT 654 Query: 15 LASLV 1 L V Sbjct: 655 LTKAV 659 >emb|CAB10337.1| reverse transcriptase like protein [Arabidopsis thaliana] gi|7268307|emb|CAB78601.1| reverse transcriptase like protein [Arabidopsis thaliana] Length = 929 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/72 (37%), Positives = 44/72 (61%) Frame = -2 Query: 216 NQIWSFFQQAIKEKLGFSITTNLGQYLGVPVLHERRSKKTYHELVQKVEAKLNGWKHNQL 37 N + + I + G T LG+YLG+PVL +R +K T+ E++++V ++L+GWK L Sbjct: 523 NNVSRDLEGLITAETGIGSTRELGKYLGMPVLQKRINKDTFGEVLERVSSRLSGWKSRSL 582 Query: 36 TFAGRVILASLV 1 + AGR+ L V Sbjct: 583 SLAGRITLTKAV 594 >emb|CAB78008.1| putative protein [Arabidopsis thaliana] gi|7321072|emb|CAB82119.1| putative protein [Arabidopsis thaliana] Length = 947 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/65 (40%), Positives = 43/65 (66%) Frame = -2 Query: 195 QQAIKEKLGFSITTNLGQYLGVPVLHERRSKKTYHELVQKVEAKLNGWKHNQLTFAGRVI 16 ++ I ++ G T LG+YLG+P+L R +K T+ E++++V ++L GWK L+FAGR+ Sbjct: 409 EKLISKESGIKSTRELGKYLGMPILQRRINKDTFGEVLERVSSRLAGWKGRSLSFAGRLT 468 Query: 15 LASLV 1 L V Sbjct: 469 LTKSV 473 >gb|AAD37021.1| putative non-LTR retrolelement reverse transcriptase [Arabidopsis thaliana] Length = 732 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/62 (43%), Positives = 40/62 (64%) Frame = -2 Query: 186 IKEKLGFSITTNLGQYLGVPVLHERRSKKTYHELVQKVEAKLNGWKHNQLTFAGRVILAS 7 I ++ G S T LG+YLG+PVL R +K T+ ++++K+ +L GWK L+ AGRV L Sbjct: 260 ISDESGISSTRELGKYLGMPVLQRRINKDTFGDILEKLTTRLAGWKGRFLSLAGRVTLTK 319 Query: 6 LV 1 V Sbjct: 320 AV 321