BLASTX nr result
ID: Cephaelis21_contig00045951
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00045951 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD45562.1| reverse transcriptase [Elaeis guineensis] 55 2e-06 gb|EAZ22996.1| hypothetical protein OsJ_06691 [Oryza sativa Japo... 55 6e-06 >emb|CAD45562.1| reverse transcriptase [Elaeis guineensis] Length = 137 Score = 55.5 bits (132), Expect(2) = 2e-06 Identities = 28/64 (43%), Positives = 42/64 (65%) Frame = -2 Query: 278 RVLCD*LQPLMPTLISPEQL*FFQ*RDIHDNVLLAQELAQHLHKRLRGSNVIFKLDIMKA 99 R+ D L ++P +IS Q F + R+I +N+ LAQEL Q +++ G NVI KLD+ KA Sbjct: 18 RLFNDRLASILPLIISENQGAFVKGRNILENISLAQELTQEFNRKCYGHNVIIKLDMGKA 77 Query: 98 FDWV 87 +DW+ Sbjct: 78 YDWL 81 Score = 21.2 bits (43), Expect(2) = 2e-06 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 78 FF*KMLLRFGFSVALVNVI 22 F ++LLRFGF VN I Sbjct: 85 FLFQVLLRFGFHPGWVNYI 103 >gb|EAZ22996.1| hypothetical protein OsJ_06691 [Oryza sativa Japonica Group] Length = 476 Score = 55.1 bits (131), Expect = 6e-06 Identities = 31/76 (40%), Positives = 46/76 (60%), Gaps = 2/76 (2%) Frame = -2 Query: 260 LQPLMPTLISPEQL*FFQ*RDIHDNVLLAQELAQHLHKRLRGSNVIFKLDIMKAFDWVSR 81 L PL+P ++S Q F + R IHDN LL Q++A+ L+ + + ++V+ KLDI KAFD V Sbjct: 5 LAPLLPGMVSVNQSAFVKRRSIHDNFLLVQQMARRLYSK-KEAHVMLKLDISKAFDSVDW 63 Query: 80 FFFEK--CYSGLASLW 39 F + C+ G W Sbjct: 64 SFLLEVLCHLGFGRRW 79