BLASTX nr result
ID: Cephaelis21_contig00045683
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00045683 (240 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275567.1| PREDICTED: cell surface receptor daf-1 [Viti... 55 6e-06 >ref|XP_002275567.1| PREDICTED: cell surface receptor daf-1 [Vitis vinifera] gi|297745851|emb|CBI15907.3| unnamed protein product [Vitis vinifera] Length = 592 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -3 Query: 238 QILENVMKKCWKNCPSKRPQFSEILSLLVFPVD*SN 131 QIL ++M KCW NCPSKRPQFSEILS+L+ P + +N Sbjct: 546 QILRSLMTKCWNNCPSKRPQFSEILSILLRPNNSNN 581