BLASTX nr result
ID: Cephaelis21_contig00045528
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00045528 (337 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAL68165.1| ethylene response factor #74 [Nicotiana tabacum] 57 1e-06 >dbj|BAL68165.1| ethylene response factor #74 [Nicotiana tabacum] Length = 173 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/47 (59%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = -2 Query: 336 EARAARSEYNGYKLDTIGMVMNERETEIKTD-KKPVLFDLNQPAPLF 199 E A SEY+GY L+ +G+VMNE E + K + KKP LFDLN PAPLF Sbjct: 127 ETTVASSEYSGYNLEGVGVVMNEHEKKTKIEKKKPFLFDLNLPAPLF 173