BLASTX nr result
ID: Cephaelis21_contig00045204
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00045204 (244 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002874962.1| zinc finger family protein [Arabidopsis lyra... 60 2e-07 ref|XP_002281242.1| PREDICTED: probable S-acyltransferase At4g01... 60 2e-07 emb|CAN83141.1| hypothetical protein VITISV_035325 [Vitis vinifera] 60 2e-07 gb|AAC72868.1| contains similarity to human DHHC-domain-containi... 59 4e-07 ref|NP_192082.4| DHHC-type zinc finger protein [Arabidopsis thal... 59 4e-07 >ref|XP_002874962.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297320799|gb|EFH51221.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Length = 508 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +3 Query: 18 ENRYRSNFDLHLTSVSKELESYISRQVLFSVLREGGNETSP 140 + +YRSNFDL LT VS+ELESYISRQVL SV+++ G+E SP Sbjct: 467 KQKYRSNFDLKLTEVSRELESYISRQVLCSVIKQDGSEASP 507 >ref|XP_002281242.1| PREDICTED: probable S-acyltransferase At4g01730 [Vitis vinifera] gi|297744084|emb|CBI37054.3| unnamed protein product [Vitis vinifera] Length = 506 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = +3 Query: 18 ENRYRSNFDLHLTSVSKELESYISRQVLFSVLREGGNETSP 140 +++YRSNFDL LT VS+ELE+YISRQVL SVL++ G+E SP Sbjct: 465 KHKYRSNFDLKLTEVSRELETYISRQVLCSVLKKDGSEASP 505 >emb|CAN83141.1| hypothetical protein VITISV_035325 [Vitis vinifera] Length = 968 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = +3 Query: 18 ENRYRSNFDLHLTSVSKELESYISRQVLFSVLREGGNETSP 140 +++YRSNFDL LT VS+ELE+YISRQVL SVL++ G+E SP Sbjct: 927 KHKYRSNFDLKLTEVSRELETYISRQVLCSVLKKDGSEASP 967 >gb|AAC72868.1| contains similarity to human DHHC-domain-containing cysteine-rich protein (GB:U90653) and several S. cerevisiae probable membrane proteins (GB:U20865, Z48758, U43491) [Arabidopsis thaliana] Length = 513 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = +3 Query: 18 ENRYRSNFDLHLTSVSKELESYISRQVLFSVLREGGNETSP 140 + +YR+NFDL LT VS+ELESYISRQVL SV+++ G+E SP Sbjct: 472 KQKYRTNFDLKLTEVSRELESYISRQVLCSVIKQDGSEASP 512 >ref|NP_192082.4| DHHC-type zinc finger protein [Arabidopsis thaliana] gi|378405219|sp|Q9M115.2|ZDH16_ARATH RecName: Full=Probable S-acyltransferase At4g01730; AltName: Full=Probable palmitoyltransferase At4g01730; AltName: Full=Zinc finger DHHC domain-containing protein At4g01730 gi|332656670|gb|AEE82070.1| DHHC-type zinc finger protein [Arabidopsis thaliana] Length = 508 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = +3 Query: 18 ENRYRSNFDLHLTSVSKELESYISRQVLFSVLREGGNETSP 140 + +YR+NFDL LT VS+ELESYISRQVL SV+++ G+E SP Sbjct: 467 KQKYRTNFDLKLTEVSRELESYISRQVLCSVIKQDGSEASP 507