BLASTX nr result
ID: Cephaelis21_contig00044376
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00044376 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_358628.1| hypothetical protein PhapfoPp082 [Phalaenopsis ... 76 2e-12 >ref|YP_358628.1| hypothetical protein PhapfoPp082 [Phalaenopsis aphrodite subsp. formosana] gi|58802845|gb|AAW82565.1| hypothetical protein [Phalaenopsis aphrodite subsp. formosana] Length = 81 Score = 76.3 bits (186), Expect = 2e-12 Identities = 38/42 (90%), Positives = 38/42 (90%) Frame = +3 Query: 6 ATFEVTERKATTGVGESESKRVFLTSFSHSKPCMRLSYHTAP 131 ATFEVTERKATTGVGESESKR FLTS SHSKPCMRLS TAP Sbjct: 39 ATFEVTERKATTGVGESESKRGFLTSLSHSKPCMRLSPRTAP 80