BLASTX nr result
ID: Cephaelis21_contig00043965
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00043965 (379 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71465.1| hypothetical protein VITISV_038986 [Vitis vinifera] 103 2e-20 ref|XP_003588265.1| NADH-ubiquinone oxidoreductase chain [Medica... 83 2e-14 >emb|CAN71465.1| hypothetical protein VITISV_038986 [Vitis vinifera] Length = 564 Score = 103 bits (256), Expect = 2e-20 Identities = 50/60 (83%), Positives = 52/60 (86%), Gaps = 2/60 (3%) Frame = -3 Query: 377 KKTDRTRSSYWLVRPGSIHESLVQLSLGDRVEKYHTWLPPVLSFYRSHPARYDRA--QPK 204 + +DRTRSSYWLVRPGSIHESLVQLSLGD VEKYH WLPPVLSF RSHPARY A QPK Sbjct: 241 RASDRTRSSYWLVRPGSIHESLVQLSLGDTVEKYHAWLPPVLSFSRSHPARYGSAKKQPK 300 >ref|XP_003588265.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] gi|355477313|gb|AES58516.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] Length = 346 Score = 83.2 bits (204), Expect = 2e-14 Identities = 42/61 (68%), Positives = 46/61 (75%) Frame = +2 Query: 194 RVPFLAEPYRILLGETDRKKGRGATMYGTSRPCLRGTVERATHECCQVGRANNSNAFGLF 373 R FLAEPY L DR++ R + SRPCLRGTVERATHECC+VGRANNSNAFGLF Sbjct: 224 RSRFLAEPY---LAGWDREQERTGGNHACSRPCLRGTVERATHECCRVGRANNSNAFGLF 280 Query: 374 F 376 F Sbjct: 281 F 281