BLASTX nr result
ID: Cephaelis21_contig00043924
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00043924 (532 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD45561.1| reverse transcriptase [Elaeis guineensis] 56 3e-06 >emb|CAD45561.1| reverse transcriptase [Elaeis guineensis] Length = 137 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/47 (51%), Positives = 33/47 (70%) Frame = +2 Query: 392 QSINRKVGGHNILIKLDMQKALNRVLWEFLSSVFFKFGFHQRFIDLI 532 Q NRK GHN++IKLDM KA +R+ W+FL V +FGFH +++ I Sbjct: 57 QEFNRKCYGHNVIIKLDMGKAYDRLEWDFLFQVLLRFGFHPGWVNYI 103