BLASTX nr result
ID: Cephaelis21_contig00043880
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00043880 (476 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAK02380.1| predicted protein [Hordeum vulgare subsp. vulgare] 59 5e-07 ref|XP_002271384.1| PREDICTED: vacuolar protein sorting-associat... 58 7e-07 gb|AFW56871.1| hypothetical protein ZEAMMB73_493702 [Zea mays] 58 9e-07 ref|XP_002443948.1| hypothetical protein SORBIDRAFT_07g004940 [S... 58 9e-07 gb|AAF79641.1|AC025416_15 F5O11.22 [Arabidopsis thaliana] 57 1e-06 >dbj|BAK02380.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 600 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -3 Query: 474 APFYAFPCGHCFHAQCLLTHVTSCTNQIQVSSRILS 367 APFY FPCGH FHA CL+ HVT CT+Q+Q + RIL+ Sbjct: 474 APFYVFPCGHAFHANCLIAHVTRCTSQVQ-AERILN 508 >ref|XP_002271384.1| PREDICTED: vacuolar protein sorting-associated protein 18 homolog [Vitis vinifera] gi|296084966|emb|CBI28381.3| unnamed protein product [Vitis vinifera] Length = 986 Score = 58.2 bits (139), Expect = 7e-07 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = -3 Query: 474 APFYAFPCGHCFHAQCLLTHVTSCTNQIQ 388 APFY FPCGH FHAQCL+THVT CT + Q Sbjct: 862 APFYVFPCGHAFHAQCLITHVTQCTTRAQ 890 >gb|AFW56871.1| hypothetical protein ZEAMMB73_493702 [Zea mays] Length = 183 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -3 Query: 474 APFYAFPCGHCFHAQCLLTHVTSCTNQIQVSSRIL 370 APFY FPCGH FHA CL+ HVT C+NQ+Q + RIL Sbjct: 58 APFYVFPCGHAFHANCLIGHVTRCSNQVQ-AERIL 91 >ref|XP_002443948.1| hypothetical protein SORBIDRAFT_07g004940 [Sorghum bicolor] gi|241940298|gb|EES13443.1| hypothetical protein SORBIDRAFT_07g004940 [Sorghum bicolor] Length = 995 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -3 Query: 474 APFYAFPCGHCFHAQCLLTHVTSCTNQIQVSSRIL 370 APFY FPCGH FHA CL+ HVT C+NQ+Q + RIL Sbjct: 870 APFYVFPCGHAFHANCLIGHVTRCSNQVQ-AERIL 903 >gb|AAF79641.1|AC025416_15 F5O11.22 [Arabidopsis thaliana] Length = 1063 Score = 57.4 bits (137), Expect = 1e-06 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = -3 Query: 474 APFYAFPCGHCFHAQCLLTHVTSCTNQIQ 388 APFY FPCGH FHAQCL+THVTSC ++ Q Sbjct: 938 APFYVFPCGHSFHAQCLITHVTSCAHEEQ 966