BLASTX nr result
ID: Cephaelis21_contig00043745
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00043745 (383 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19505.3| unnamed protein product [Vitis vinifera] 128 6e-28 gb|ABK95877.1| unknown [Populus trichocarpa] 128 6e-28 ref|XP_002284836.1| PREDICTED: heat stress transcription factor ... 128 6e-28 ref|XP_003528294.1| PREDICTED: heat stress transcription factor ... 127 1e-27 gb|ADL36735.1| HSF domain class transcription factor [Malus x do... 126 2e-27 >emb|CBI19505.3| unnamed protein product [Vitis vinifera] Length = 281 Score = 128 bits (321), Expect = 6e-28 Identities = 59/60 (98%), Positives = 59/60 (98%) Frame = +1 Query: 202 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFVVWRPPEFA 381 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP TDHIVSWGEDDTTFVVWRPPEFA Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA 60 >gb|ABK95877.1| unknown [Populus trichocarpa] Length = 368 Score = 128 bits (321), Expect = 6e-28 Identities = 59/60 (98%), Positives = 59/60 (98%) Frame = +1 Query: 202 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFVVWRPPEFA 381 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP TDHIVSWGEDDTTFVVWRPPEFA Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA 60 >ref|XP_002284836.1| PREDICTED: heat stress transcription factor B-4 [Vitis vinifera] gi|147768919|emb|CAN66983.1| hypothetical protein VITISV_004457 [Vitis vinifera] Length = 363 Score = 128 bits (321), Expect = 6e-28 Identities = 59/60 (98%), Positives = 59/60 (98%) Frame = +1 Query: 202 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFVVWRPPEFA 381 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP TDHIVSWGEDDTTFVVWRPPEFA Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA 60 >ref|XP_003528294.1| PREDICTED: heat stress transcription factor B-4-like [Glycine max] gi|83853831|gb|ABC47863.1| Heat shock transcription factor (HSF) [Glycine max] Length = 363 Score = 127 bits (318), Expect = 1e-27 Identities = 58/60 (96%), Positives = 59/60 (98%) Frame = +1 Query: 202 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFVVWRPPEFA 381 MAL+LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP TDHIVSWGEDDTTFVVWRPPEFA Sbjct: 1 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFVVWRPPEFA 60 >gb|ADL36735.1| HSF domain class transcription factor [Malus x domestica] Length = 383 Score = 126 bits (316), Expect = 2e-27 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = +1 Query: 202 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFVVWRPPEFA 381 MALM+DNCEGILLSLDSHKSVPAPFLTKTYQLVDDP TDHIVSWG+DDTTFVVWRPPEFA Sbjct: 1 MALMIDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGDDDTTFVVWRPPEFA 60