BLASTX nr result
ID: Cephaelis21_contig00043629
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00043629 (247 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGE93444.1| ATP synthase CF0 subunit IV [Xiphidium caeruleum] 57 3e-13 ref|YP_001718697.1| ATP synthase CF0 subunit IV [Trachelium caer... 53 3e-13 ref|YP_817470.1| ATP synthase CF0 subunit IV [Coffea arabica] gi... 53 3e-13 gb|ACH47677.1| ATP synthase CF0 subunit IV [Sarcocaulon vanderie... 54 4e-13 ref|YP_003934340.1| ATP synthase CF0 subunit IV [Monsonia specio... 54 5e-13 >gb|AGE93444.1| ATP synthase CF0 subunit IV [Xiphidium caeruleum] Length = 247 Score = 57.0 bits (136), Expect(2) = 3e-13 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = -1 Query: 175 SKTQIGEQYGPWVPFIGTPFLLIFVCN 95 SKTQIGE+YGPWVPFIGT FL IFVCN Sbjct: 83 SKTQIGEEYGPWVPFIGTMFLFIFVCN 109 Score = 42.7 bits (99), Expect(2) = 3e-13 Identities = 18/28 (64%), Positives = 23/28 (82%) Frame = -2 Query: 243 DPQTTPTGVQNFFKYVLEFIRDIVKLKL 160 +PQT PT QNFF+YVLEFIRD+ K ++ Sbjct: 60 NPQTVPTNGQNFFEYVLEFIRDLSKTQI 87 >ref|YP_001718697.1| ATP synthase CF0 subunit IV [Trachelium caeruleum] gi|223635060|sp|A9QC93.1|ATPI_TRACE RecName: Full=ATP synthase subunit a, chloroplastic; AltName: Full=ATP synthase F0 sector subunit a; AltName: Full=F-ATPase subunit IV gi|156598867|gb|ABU85686.1| ATP synthase CF0 subunit IV [Trachelium caeruleum] gi|157267529|gb|ABV26522.1| ATP synthase CF0 subunit IV (chloroplast) [Trachelium caeruleum] Length = 247 Score = 52.8 bits (125), Expect(2) = 3e-13 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 175 SKTQIGEQYGPWVPFIGTPFLLIFVCN 95 SKTQIGE+YGPWVPFIGT FL IFV N Sbjct: 83 SKTQIGEEYGPWVPFIGTIFLFIFVSN 109 Score = 47.0 bits (110), Expect(2) = 3e-13 Identities = 19/27 (70%), Positives = 24/27 (88%) Frame = -2 Query: 240 PQTTPTGVQNFFKYVLEFIRDIVKLKL 160 PQT PTG+QNFF+YVLEFIRD+ K ++ Sbjct: 61 PQTIPTGIQNFFEYVLEFIRDVSKTQI 87 >ref|YP_817470.1| ATP synthase CF0 subunit IV [Coffea arabica] gi|122153609|sp|A0A323.1|ATPI_COFAR RecName: Full=ATP synthase subunit a, chloroplastic; AltName: Full=ATP synthase F0 sector subunit a; AltName: Full=F-ATPase subunit IV gi|116242152|gb|ABJ89667.1| ATP synthase CF0 subunit IV [Coffea arabica] Length = 244 Score = 52.8 bits (125), Expect(2) = 3e-13 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 175 SKTQIGEQYGPWVPFIGTPFLLIFVCN 95 SKTQIGE+YGPWVPFIGT FL IFV N Sbjct: 80 SKTQIGEEYGPWVPFIGTLFLFIFVSN 106 Score = 47.0 bits (110), Expect(2) = 3e-13 Identities = 20/28 (71%), Positives = 24/28 (85%) Frame = -2 Query: 243 DPQTTPTGVQNFFKYVLEFIRDIVKLKL 160 DPQT PTG QNFF+YVLEFIRD+ K ++ Sbjct: 57 DPQTIPTGGQNFFEYVLEFIRDVSKTQI 84 >gb|ACH47677.1| ATP synthase CF0 subunit IV [Sarcocaulon vanderietiae] Length = 248 Score = 53.9 bits (128), Expect(2) = 4e-13 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -1 Query: 175 SKTQIGEQYGPWVPFIGTPFLLIFVCNLERSTF 77 SKTQIGE+YGPWVPFIGT FL IFV N + F Sbjct: 84 SKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALF 116 Score = 45.4 bits (106), Expect(2) = 4e-13 Identities = 19/28 (67%), Positives = 24/28 (85%) Frame = -2 Query: 243 DPQTTPTGVQNFFKYVLEFIRDIVKLKL 160 +PQT PT VQNFF+YVLEFIRD+ K ++ Sbjct: 61 NPQTVPTDVQNFFEYVLEFIRDVSKTQI 88 >ref|YP_003934340.1| ATP synthase CF0 subunit IV [Monsonia speciosa] gi|197132316|gb|ACH47676.1| ATP synthase CF0 subunit IV [Monsonia speciosa] gi|300069355|gb|ADJ66475.1| ATP synthase CF0 subunit IV [Monsonia speciosa] Length = 248 Score = 53.9 bits (128), Expect(2) = 5e-13 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -1 Query: 175 SKTQIGEQYGPWVPFIGTPFLLIFVCNLERSTF 77 SKTQIGE+YGPWVPFIGT FL IFV N + F Sbjct: 84 SKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALF 116 Score = 45.1 bits (105), Expect(2) = 5e-13 Identities = 19/28 (67%), Positives = 24/28 (85%) Frame = -2 Query: 243 DPQTTPTGVQNFFKYVLEFIRDIVKLKL 160 +PQT PT VQNFF+YVLEFIRD+ K ++ Sbjct: 61 NPQTIPTDVQNFFEYVLEFIRDVSKTQI 88