BLASTX nr result
ID: Cephaelis21_contig00042906
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00042906 (652 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA65996.1| hypothetical protein [Beta vulgaris subsp. vulga... 58 2e-06 >emb|CCA65996.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 744 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/62 (40%), Positives = 39/62 (62%) Frame = +1 Query: 406 VWIGFPRLLIHFCDRTCVFAIASLIGTPLRIDWATASLKRPSMARVQVELHLLEEKPEKI 585 VWI FP L + + D+ +FAIA +G P+++D+AT + R ARV +EL L + K+ Sbjct: 211 VWIRFPELPLEYYDKEALFAIAGKVGKPIKVDYATDHMARGRYARVCIELDLAKALVSKV 270 Query: 586 WI 591 W+ Sbjct: 271 WV 272