BLASTX nr result
ID: Cephaelis21_contig00042800
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00042800 (293 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAW63130.1| 31 kDa putative protein [Strawberry latent ringsp... 108 3e-22 ref|NP_620833.1| 36 kDa protein [Strawberry latent ringspot viru... 75 7e-12 >gb|AAW63130.1| 31 kDa putative protein [Strawberry latent ringspot virus satellite RNA] Length = 287 Score = 108 bits (271), Expect = 3e-22 Identities = 54/97 (55%), Positives = 66/97 (68%) Frame = -3 Query: 291 RALVLSGRRLMPVGLPEDHSTDPFASPLPRGPVPARRVVHVEPFTWDNMSYGQCSRTLAL 112 R L SGRRL GLP +DPFASP P P +V HV+P +W+ MS+GQCSR L L Sbjct: 173 RTLAFSGRRLSVSGLPS--GSDPFASPSPVRPALTPKVAHVDPVSWEGMSFGQCSRALTL 230 Query: 111 YKQLTSCFGSKMFQATLYKEAVKKVCKLTDAVPVSIP 1 YKQL SCFG KMF ++LY AV+KV +L + PV+IP Sbjct: 231 YKQLCSCFGVKMFSSSLYGMAVRKVLRLREDFPVAIP 267 >ref|NP_620833.1| 36 kDa protein [Strawberry latent ringspot virus satellite RNA] gi|478364|pir||JQ2018 hypothetical 36.5K protein - strawberry latent ringspot virus gi|312511|emb|CAA49480.1| 36 kDa protein [Strawberry latent ringspot virus satellite RNA] Length = 331 Score = 74.7 bits (182), Expect = 7e-12 Identities = 41/89 (46%), Positives = 52/89 (58%), Gaps = 1/89 (1%) Frame = -3 Query: 291 RALVLSGRRLMPVGLPEDHSTDPFASPLPR-GPVPARRVVHVEPFTWDNMSYGQCSRTLA 115 RA SG+RL GLPE P S L R + HV+P +W+ MS+GQCSR L Sbjct: 173 RAFAFSGKRLSVSGLPEG----PIPSLLLRQSACNCPKGCHVDPVSWEGMSFGQCSRALT 228 Query: 114 LYKQLTSCFGSKMFQATLYKEAVKKVCKL 28 LY+QL CFG KMF ++LY AV++ L Sbjct: 229 LYRQLCGCFGMKMFSSSLYGMAVRRFSAL 257