BLASTX nr result
ID: Cephaelis21_contig00042051
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00042051 (375 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525682.1| Sodium/potassium/calcium exchanger 6 precurs... 61 1e-07 ref|XP_002270512.2| PREDICTED: cation/calcium exchanger 3-like [... 60 2e-07 >ref|XP_002525682.1| Sodium/potassium/calcium exchanger 6 precursor, putative [Ricinus communis] gi|223534982|gb|EEF36665.1| Sodium/potassium/calcium exchanger 6 precursor, putative [Ricinus communis] Length = 595 Score = 60.8 bits (146), Expect = 1e-07 Identities = 41/123 (33%), Positives = 62/123 (50%) Frame = +1 Query: 7 AICYVCIYFLYIFLVCAMQFFYGKKERIVNPPATHRTSRQNVLALTSDDYGAVCTPLIEP 186 AI ++ IYF Y+ +VC M F + K++++ P T S ++ + +D + PL+ Sbjct: 237 AIAFLSIYFFYVCVVCFMHFLFRKEKKVT--PLTVSPSSNGLITDSQEDVVEMGIPLLGY 294 Query: 187 VDEEKGELQFEDDSHKVCSEKEPKKSLFSFGPXXXXXXXXXXXXXXEFPLYLPRRITIPM 366 VD+EK F D S+ + E E + L E PLYLPRR+TIP+ Sbjct: 295 VDDEKPN--FVDKSNHL--EDEQQNPLCLNLDSSFCYYLGRFLYLLELPLYLPRRLTIPV 350 Query: 367 VSE 375 VSE Sbjct: 351 VSE 353 >ref|XP_002270512.2| PREDICTED: cation/calcium exchanger 3-like [Vitis vinifera] Length = 593 Score = 60.1 bits (144), Expect = 2e-07 Identities = 43/123 (34%), Positives = 59/123 (47%) Frame = +1 Query: 7 AICYVCIYFLYIFLVCAMQFFYGKKERIVNPPATHRTSRQNVLALTSDDYGAVCTPLIEP 186 ++C+V IYF Y+ V + ++E +V+ SR L + D+ G TPL+ Sbjct: 244 SVCFVSIYFFYVCAVSTTHILWKREESVVDLYDISPDSRSFFLR-SHDELGENGTPLLGY 302 Query: 187 VDEEKGELQFEDDSHKVCSEKEPKKSLFSFGPXXXXXXXXXXXXXXEFPLYLPRRITIPM 366 VDEEK L D EK+ K+ F EFPLYLPRR+TIP+ Sbjct: 303 VDEEKPNLAERRDPE---GEKQSKR--FWNPDSSTCYYWGWFLYVLEFPLYLPRRLTIPV 357 Query: 367 VSE 375 VSE Sbjct: 358 VSE 360