BLASTX nr result
ID: Cephaelis21_contig00041486
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00041486 (202 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAK61873.1| F-box / LRR-repeat protein [Citrus unshiu] 62 6e-08 ref|XP_004157405.1| PREDICTED: F-box/LRR-repeat protein 15-like ... 58 9e-07 ref|XP_004141343.1| PREDICTED: LOW QUALITY PROTEIN: F-box/LRR-re... 58 9e-07 ref|XP_002324196.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 ref|XP_002516134.1| conserved hypothetical protein [Ricinus comm... 57 1e-06 >dbj|BAK61873.1| F-box / LRR-repeat protein [Citrus unshiu] Length = 1068 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -1 Query: 112 CGDTYFALSSNCCSLETLKLDCPRLTSLFLQSCNINE 2 C + F SNCCSLETLKLDCP+LTSLFLQSCNI+E Sbjct: 983 CFNLCFLNLSNCCSLETLKLDCPKLTSLFLQSCNIDE 1019 >ref|XP_004157405.1| PREDICTED: F-box/LRR-repeat protein 15-like [Cucumis sativus] Length = 118 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -1 Query: 85 SNCCSLETLKLDCPRLTSLFLQSCNINE 2 SNCCSLE LKLDCPRLT+LFLQSCNI E Sbjct: 42 SNCCSLEVLKLDCPRLTNLFLQSCNIEE 69 >ref|XP_004141343.1| PREDICTED: LOW QUALITY PROTEIN: F-box/LRR-repeat protein 15-like [Cucumis sativus] Length = 1042 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -1 Query: 85 SNCCSLETLKLDCPRLTSLFLQSCNINE 2 SNCCSLE LKLDCPRLT+LFLQSCNI E Sbjct: 966 SNCCSLEVLKLDCPRLTNLFLQSCNIEE 993 >ref|XP_002324196.1| predicted protein [Populus trichocarpa] gi|222865630|gb|EEF02761.1| predicted protein [Populus trichocarpa] Length = 957 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -1 Query: 112 CGDTYFALSSNCCSLETLKLDCPRLTSLFLQSCNINE 2 C + + SNCCSLE LKL+CPRLTSLFLQSCNI+E Sbjct: 875 CFNLCYLNLSNCCSLEILKLECPRLTSLFLQSCNIDE 911 >ref|XP_002516134.1| conserved hypothetical protein [Ricinus communis] gi|223544620|gb|EEF46136.1| conserved hypothetical protein [Ricinus communis] Length = 997 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 85 SNCCSLETLKLDCPRLTSLFLQSCNINE 2 SNCCSLE LKL+CPRLTSLFLQSCNI+E Sbjct: 921 SNCCSLEILKLECPRLTSLFLQSCNIDE 948