BLASTX nr result
ID: Cephaelis21_contig00041366
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00041366 (372 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516609.1| pentatricopeptide repeat-containing protein,... 57 1e-11 ref|XP_003631786.1| PREDICTED: pentatricopeptide repeat-containi... 64 1e-08 emb|CAN63320.1| hypothetical protein VITISV_026425 [Vitis vinifera] 64 1e-08 >ref|XP_002516609.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223544429|gb|EEF45950.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 463 Score = 57.4 bits (137), Expect(2) = 1e-11 Identities = 26/56 (46%), Positives = 37/56 (66%) Frame = +1 Query: 118 VDSLSMLKLTLRLSYVPTEPTLNMLILGLSNAGMVREAYFVLCVLLDKGKFLGAYT 285 +DS+ + ++ L L YVP++ T N++I L AGM REAYFV L +KG F G +T Sbjct: 62 MDSIFVFEVMLTLGYVPSKSTSNLMICSLCKAGMAREAYFVFSFLFNKGHFFGVFT 117 Score = 37.0 bits (84), Expect(2) = 1e-11 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = +2 Query: 5 LKHGVYIAEEMCGCGFLPSFPCLSKLLK 88 L+ ++I EEM G GF+PSF LSKLLK Sbjct: 26 LEDAIFILEEMRGSGFVPSFSILSKLLK 53 >ref|XP_003631786.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Vitis vinifera] Length = 629 Score = 64.3 bits (155), Expect = 1e-08 Identities = 38/90 (42%), Positives = 53/90 (58%), Gaps = 2/90 (2%) Frame = +1 Query: 43 VWVFALIPLFIEVVEEINS-VWQFEYVDSLSMLKLTLRLSYVPTEPTLNMLILGLSNAGM 219 +W +P F +++ + + VDS+S+ + LRL Y PTEPTLN+LI LS AGM Sbjct: 36 MWRSGFLPSFTSLLKILKKWLGLGSLVDSMSVFEFMLRLEYFPTEPTLNLLISMLSKAGM 95 Query: 220 VREAYFVLCVLLDKGKFLGAYTLT-LSWGL 306 REA+FV VLL KG A++ + W L Sbjct: 96 AREAHFVFRVLLGKGCLKCAHSYNPILWAL 125 >emb|CAN63320.1| hypothetical protein VITISV_026425 [Vitis vinifera] Length = 722 Score = 64.3 bits (155), Expect = 1e-08 Identities = 38/90 (42%), Positives = 53/90 (58%), Gaps = 2/90 (2%) Frame = +1 Query: 43 VWVFALIPLFIEVVEEINS-VWQFEYVDSLSMLKLTLRLSYVPTEPTLNMLILGLSNAGM 219 +W +P F +++ + + VDS+S+ + LRL Y PTEPTLN+LI LS AGM Sbjct: 144 MWRSGFLPSFTSLLKILKKWLGLGSLVDSMSVFEFMLRLEYFPTEPTLNLLISMLSKAGM 203 Query: 220 VREAYFVLCVLLDKGKFLGAYTLT-LSWGL 306 REA+FV VLL KG A++ + W L Sbjct: 204 AREAHFVFRVLLGKGCLKCAHSYNPILWAL 233