BLASTX nr result
ID: Cephaelis21_contig00041356
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00041356 (410 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522795.1| organic anion transporter, putative [Ricinus... 59 3e-07 ref|XP_002298882.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_003617863.1| Solute carrier family 35 member E3 [Medicago... 56 3e-06 gb|AFK36028.1| unknown [Lotus japonicus] 55 5e-06 >ref|XP_002522795.1| organic anion transporter, putative [Ricinus communis] gi|223538033|gb|EEF39646.1| organic anion transporter, putative [Ricinus communis] Length = 389 Score = 59.3 bits (142), Expect = 3e-07 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = +1 Query: 1 SDPGTLSICGAVTALSGMSVYTSLNLKESREKASSSLLPKQNLP 132 SDPG +SI GAV AL GMS YTSLNL+ESREK +S L KQ LP Sbjct: 319 SDPGFVSIGGAVAALGGMSAYTSLNLQESREKVLNSQLLKQTLP 362 >ref|XP_002298882.1| predicted protein [Populus trichocarpa] gi|222846140|gb|EEE83687.1| predicted protein [Populus trichocarpa] Length = 378 Score = 56.2 bits (134), Expect = 3e-06 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = +1 Query: 1 SDPGTLSICGAVTALSGMSVYTSLNLKESREKASSSLLPKQNLP 132 SDPG +SICGA+TAL+GMSVYTSLNL+ESRE L Q LP Sbjct: 319 SDPGFVSICGALTALAGMSVYTSLNLQESRENLIFQ-LQTQTLP 361 >ref|XP_003617863.1| Solute carrier family 35 member E3 [Medicago truncatula] gi|355519198|gb|AET00822.1| Solute carrier family 35 member E3 [Medicago truncatula] Length = 388 Score = 55.8 bits (133), Expect = 3e-06 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = +1 Query: 1 SDPGTLSICGAVTALSGMSVYTSLNLKESREKASSSLLPKQNLPS 135 SDPG +SI GAV AL+GMSVYT+ NL+ES+E S LPK +LPS Sbjct: 321 SDPGIVSIGGAVVALTGMSVYTTFNLQESQENTSKQ-LPKHSLPS 364 >gb|AFK36028.1| unknown [Lotus japonicus] Length = 384 Score = 55.5 bits (132), Expect = 5e-06 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +1 Query: 1 SDPGTLSICGAVTALSGMSVYTSLNLKESREKASSSLLPKQNLP 132 SDPG +SI GAV ALSGMS+YT+LNL+ES+E ++S LPKQ P Sbjct: 318 SDPGVISIRGAVVALSGMSIYTTLNLQESQE-STSKQLPKQVSP 360