BLASTX nr result
ID: Cephaelis21_contig00041210
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00041210 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003555059.1| PREDICTED: uncharacterized protein LOC100780... 67 1e-09 ref|XP_003592704.1| Lysine-specific demethylase 3B [Medicago tru... 66 3e-09 ref|XP_003636724.1| Lysine-specific demethylase 3B [Medicago tru... 65 6e-09 ref|XP_003592698.1| Lysine-specific demethylase 3A [Medicago tru... 65 6e-09 ref|XP_003592703.1| Lysine-specific demethylase 3B [Medicago tru... 65 8e-09 >ref|XP_003555059.1| PREDICTED: uncharacterized protein LOC100780803 [Glycine max] Length = 947 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/55 (52%), Positives = 38/55 (69%) Frame = -3 Query: 166 KVVIAEGTTPIILIQDEEGNLAESNMCHQCQRNDRGRVVRCTKCRTKRYCEPCMK 2 KV+ +P I +EE S MCHQCQRND+GR+VRCTKC+ KR+C PC++ Sbjct: 218 KVIKRNSDSPFIKFVEEE-----SLMCHQCQRNDKGRIVRCTKCKRKRFCLPCLR 267 >ref|XP_003592704.1| Lysine-specific demethylase 3B [Medicago truncatula] gi|358345318|ref|XP_003636728.1| Lysine-specific demethylase 3B [Medicago truncatula] gi|355481752|gb|AES62955.1| Lysine-specific demethylase 3B [Medicago truncatula] gi|355502663|gb|AES83866.1| Lysine-specific demethylase 3B [Medicago truncatula] Length = 1153 Score = 66.2 bits (160), Expect = 3e-09 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 100 ESNMCHQCQRNDRGRVVRCTKCRTKRYCEPCM 5 ES MCHQCQRND+GRVVRCTKC+ KRYC PC+ Sbjct: 339 ESLMCHQCQRNDKGRVVRCTKCKRKRYCIPCL 370 >ref|XP_003636724.1| Lysine-specific demethylase 3B [Medicago truncatula] gi|355502659|gb|AES83862.1| Lysine-specific demethylase 3B [Medicago truncatula] Length = 989 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 118 EEGNLAESNMCHQCQRNDRGRVVRCTKCRTKRYCEPCM 5 EEG+L MCHQCQRND+GRVVRCTKC+ +RYC PC+ Sbjct: 219 EEGSL----MCHQCQRNDKGRVVRCTKCKRRRYCIPCL 252 >ref|XP_003592698.1| Lysine-specific demethylase 3A [Medicago truncatula] gi|355481746|gb|AES62949.1| Lysine-specific demethylase 3A [Medicago truncatula] Length = 895 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 118 EEGNLAESNMCHQCQRNDRGRVVRCTKCRTKRYCEPCM 5 EEG+L MCHQCQRND+GRVVRCTKC+ +RYC PC+ Sbjct: 219 EEGSL----MCHQCQRNDKGRVVRCTKCKRRRYCIPCL 252 >ref|XP_003592703.1| Lysine-specific demethylase 3B [Medicago truncatula] gi|358345316|ref|XP_003636727.1| Lysine-specific demethylase 3B [Medicago truncatula] gi|355481751|gb|AES62954.1| Lysine-specific demethylase 3B [Medicago truncatula] gi|355502662|gb|AES83865.1| Lysine-specific demethylase 3B [Medicago truncatula] Length = 1158 Score = 64.7 bits (156), Expect = 8e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 100 ESNMCHQCQRNDRGRVVRCTKCRTKRYCEPCM 5 ES MCHQCQRND+GRVVRCTKC+ KR+C PC+ Sbjct: 323 ESLMCHQCQRNDKGRVVRCTKCKRKRFCIPCL 354