BLASTX nr result
ID: Cephaelis21_contig00041047
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00041047 (209 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002453154.1| hypothetical protein SORBIDRAFT_04g000880 [S... 56 3e-06 >ref|XP_002453154.1| hypothetical protein SORBIDRAFT_04g000880 [Sorghum bicolor] gi|241932985|gb|EES06130.1| hypothetical protein SORBIDRAFT_04g000880 [Sorghum bicolor] Length = 736 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/45 (51%), Positives = 34/45 (75%) Frame = -2 Query: 139 LSMLLLLAFWIIASFSNETGAILAKPGCKDTCGNVWIPYPFGIGS 5 L L+ A ++AS ++ T + +A+PGC++TCGN+ IPYPFGIGS Sbjct: 5 LPWLIFAATLLLASINSSTASRMARPGCRETCGNLTIPYPFGIGS 49