BLASTX nr result
ID: Cephaelis21_contig00040837
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00040837 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFN88198.1| retropepsin-like protein [Phaseolus vulgaris] 59 4e-07 >gb|AFN88198.1| retropepsin-like protein [Phaseolus vulgaris] Length = 725 Score = 58.9 bits (141), Expect = 4e-07 Identities = 23/61 (37%), Positives = 44/61 (72%) Frame = +3 Query: 18 TLLLGKPFMLTTRTNIDLDECTVSVKFDNDVVKFNLFDSMKYPAEAHSLCSIDVVDLVMQ 197 T++LG+PF+ T RT ID+ T++++F +++ +FN+ D +K+P E HS+ +D++D + Sbjct: 626 TMILGRPFLRTARTKIDVHTGTLTMEFGDNLFQFNILDVVKHPVEDHSMYHLDILDDIAD 685 Query: 198 D 200 D Sbjct: 686 D 686