BLASTX nr result
ID: Cephaelis21_contig00039835
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00039835 (220 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516625.1| conserved hypothetical protein [Ricinus comm... 70 1e-10 ref|XP_002513262.1| conserved hypothetical protein [Ricinus comm... 64 1e-08 >ref|XP_002516625.1| conserved hypothetical protein [Ricinus communis] gi|223544227|gb|EEF45749.1| conserved hypothetical protein [Ricinus communis] Length = 166 Score = 70.5 bits (171), Expect = 1e-10 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +2 Query: 2 VGAGRSFDQIPLKTVRAGLPACGSRHSRWPSPAFIRKSCS 121 VG G SFDQ+PLKTV AGLP CGS HSRW SPAFI KSCS Sbjct: 40 VGVGLSFDQVPLKTVCAGLPTCGSCHSRWSSPAFIHKSCS 79 >ref|XP_002513262.1| conserved hypothetical protein [Ricinus communis] gi|223547636|gb|EEF49130.1| conserved hypothetical protein [Ricinus communis] Length = 64 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +2 Query: 2 VGAGRSFDQIPLKTVRAGLPACGSRHSRWPSPA 100 VG GRSFDQIPLKTVRAG+PACGSRHSRW S A Sbjct: 16 VGVGRSFDQIPLKTVRAGVPACGSRHSRWSSLA 48