BLASTX nr result
ID: Cephaelis21_contig00039655
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00039655 (242 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT39957.1| Putative late blight resistance protein, identica... 55 5e-06 >gb|AAT39957.1| Putative late blight resistance protein, identical [Solanum demissum] gi|49533774|gb|AAT66773.1| Putative late blight resistance protein, identical [Solanum demissum] Length = 1268 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/58 (48%), Positives = 38/58 (65%) Frame = -2 Query: 175 ANNTSKQLITRTESPRVREVGVTLEDQQKKLIDRLTRGSSRRQVVTIVGMPGLGKTTL 2 A +T +L + P ++E + ED+ K LIDRLTRGS +++IVGMPG GKTTL Sbjct: 484 ATDTFFKLSELEKMPGIKEEIIGFEDEIKTLIDRLTRGSQELDIISIVGMPGAGKTTL 541