BLASTX nr result
ID: Cephaelis21_contig00039459
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00039459 (451 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI25349.3| unnamed protein product [Vitis vinifera] 87 1e-15 ref|XP_002275322.1| PREDICTED: glycerol-3-phosphate dehydrogenas... 87 1e-15 emb|CAN63375.1| hypothetical protein VITISV_042411 [Vitis vinifera] 87 1e-15 ref|XP_002879885.1| hypothetical protein ARALYDRAFT_483127 [Arab... 86 2e-15 ref|XP_003519217.1| PREDICTED: glycerol-3-phosphate dehydrogenas... 81 1e-13 >emb|CBI25349.3| unnamed protein product [Vitis vinifera] Length = 1241 Score = 87.0 bits (214), Expect = 1e-15 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 2/57 (3%) Frame = -2 Query: 165 AISAEGSSTD--SKDSRKVVRVAWEKLVRWSRSWRSKAKTDVLERTPKVVVLGGGSF 1 A+SA T +KD +KVVR+AWEKLVRWSRSWRSKAKTDVLERT KVVVLGGGSF Sbjct: 35 ALSANPQETSEPAKDRQKVVRIAWEKLVRWSRSWRSKAKTDVLERTNKVVVLGGGSF 91 >ref|XP_002275322.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(P)+]-like [Vitis vinifera] Length = 413 Score = 87.0 bits (214), Expect = 1e-15 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 2/57 (3%) Frame = -2 Query: 165 AISAEGSSTD--SKDSRKVVRVAWEKLVRWSRSWRSKAKTDVLERTPKVVVLGGGSF 1 A+SA T +KD +KVVR+AWEKLVRWSRSWRSKAKTDVLERT KVVVLGGGSF Sbjct: 35 ALSANPQETSEPAKDRQKVVRIAWEKLVRWSRSWRSKAKTDVLERTNKVVVLGGGSF 91 >emb|CAN63375.1| hypothetical protein VITISV_042411 [Vitis vinifera] Length = 429 Score = 87.0 bits (214), Expect = 1e-15 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 2/57 (3%) Frame = -2 Query: 165 AISAEGSSTD--SKDSRKVVRVAWEKLVRWSRSWRSKAKTDVLERTPKVVVLGGGSF 1 A+SA T +KD +KVVR+AWEKLVRWSRSWRSKAKTDVLERT KVVVLGGGSF Sbjct: 35 ALSANPQETSEPAKDRQKVVRIAWEKLVRWSRSWRSKAKTDVLERTNKVVVLGGGSF 91 >ref|XP_002879885.1| hypothetical protein ARALYDRAFT_483127 [Arabidopsis lyrata subsp. lyrata] gi|297325724|gb|EFH56144.1| hypothetical protein ARALYDRAFT_483127 [Arabidopsis lyrata subsp. lyrata] Length = 420 Score = 86.3 bits (212), Expect = 2e-15 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -2 Query: 135 SKDSRKVVRVAWEKLVRWSRSWRSKAKTDVLERTPKVVVLGGGSF 1 S+D RKVVR+AWEKLVRWSRSWR+KAKTDVLERT KVVVLGGGSF Sbjct: 54 SRDQRKVVRIAWEKLVRWSRSWRAKAKTDVLERTRKVVVLGGGSF 98 >ref|XP_003519217.1| PREDICTED: glycerol-3-phosphate dehydrogenase [NAD(P)+]-like [Glycine max] Length = 432 Score = 80.9 bits (198), Expect = 1e-13 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = -2 Query: 135 SKDSRKVVRVAWEKLVRWSRSWRSKAKTDVLERTPKVVVLGGGSF 1 ++D R++VRVAWEK+VRWSRSWRSKA TDVL+RT KVVVLGGGSF Sbjct: 66 TRDRRRIVRVAWEKIVRWSRSWRSKANTDVLQRTNKVVVLGGGSF 110